diff --git a/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg b/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg index 8e0b6bde3..0dd00fb61 100644 --- a/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg +++ b/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg @@ -14,7 +14,12 @@ width="486" height="552" viewBox="-100 -100 486 552">abc abc + + + + +abc abc + + + + +ab ab + + + +ab ab + + + +acbd acbd + + + + + +acbd acbd + + + + + +ab hello + + ab hello + + rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud + + + + + + + + + + + + + + + + + + +rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud + + + + + + + + + + + + + + + + + + +rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud + + + + + + + + + + + + + + + + + + +rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud + + + + + + + + + + + + + + + + + + +cba * cba * + + + + +cba * cba * + + + + +ab To err is human, to moo bovine1* + + ab To err is human, to moo bovine1* + + abcdefghijklmno abcdefghijklmno + + + + + + + + + + + + + + + + +abcdefghijklmno abcdefghijklmno + + + + + + + + + + + + + + + + +aaadddeeebbbccc111 222 + + + + + aaadddeeebbbccc111 222 + + + + + abcd abcd + + + + + +abcd abcd + + + + + +abc abc + + + + +abc abc + + + + +acfbdhg acfbdhg + + + + + + + + +acfbdhg acfbdhg + + + + + + + + +agdfbhec agdfbhec + + + + + + + + + +agdfbhec agdfbhec + + + + + + + + + +abcdefghijklmnopq abcdefghijklmnopq + + + + + + + + + + + + + + + + + + +abcdefghijklmnopq abcdefghijklmnopq + + + + + + + + + + + + + + + + + + +finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot + + + + + + + + + + + + + + + + + + + + + + + +finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot + + + + + + + + + + + + + + + + + + + + + + + +bacde21345abcde bacde21345abcde + + + + + + + + + + + + + + + + +bacde21345abcde bacde21345abcde + + + + + + + + + + + + + + + + +alphabeta gamma + + alphabeta gamma + + size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 + + + + + + + + + + + + diff --git a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg index c69206fcb..1c3944a12 100644 --- a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg @@ -16,6 +16,18 @@ width="1965" height="793" viewBox="-88 -88 1965 793">size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 + + + + + + + + + + + + diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg index aa40b0cde..6eabdf50e 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg @@ -1027,7 +1027,11 @@ title for the link, surrounded in quotes. For example:

Code

Unlike a pre-formatted code block, a code span indicates code within a normal paragraph. For example:

-ab hellohello + + +hellohello + + +ab ab + + + +ab ab + + + +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg index cd4553a99..2368bb846 100644 --- a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg @@ -16,6 +16,37 @@ width="860" height="4868" viewBox="-82 -88 860 4868">aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg index ee5c062cc..f832324d7 100644 --- a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg @@ -14,7 +14,42 @@ width="3244" height="1780" viewBox="-100 -100 3244 1780">abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +mixed togethersugarsolution we get + + + mixed togethersugarsolution we get + + +

Markdown: Syntax

-
ab

Markdown: Syntax

-
ab markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

-
markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

-
markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

-
markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

-

code

-
ab

code

-
ab thisgoesmultiple linesthisgoesmultiple lines + + +thisgoesmultiple linesthisgoesmultiple lines + + +abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw + + + + + + + + + + + + + + + + + + + + + + + + +abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw + + + + + + + + + + + + + + + + + + + + + + + + +abcdefghijklmnopqrstu abcdefghijklmnopqrstu + + + + + + + + + + + + + + + + + + + + + + +abcdefghijklmnopqrstu abcdefghijklmnopqrstu + + + + + + + + + + + + + + + + + + + + + + +Foo Baz12hello Foo Baz12hello + + + + + +Foo Baz12hello Foo Baz12hello + + + + + +acdefgbh acdefgbh + + + + + + + + + +acdefgbh acdefgbh + + + + + + + + + +topabcbottomstartend topabcbottomstartend + + + + + + + + +topabcbottomstartend topabcbottomstartend + + + + + + + + +xyz hello + + + xyz hello + + + abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note + + + + + + + + + + + abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note + + + + + + + + + + + scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome + + + + + + + +scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome + + + + + + + +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier + + + + + + + + abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier + + + + + + + + How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place + + + + + + + + + + + @@ -29,6 +40,7 @@ width="2374" height="2488" viewBox="-100 -100 2374 2488">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place + + + + + + + + + + + @@ -29,6 +40,7 @@ width="2374" height="2488" viewBox="-88 -88 2374 2488">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor + + diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg index f604a0366..ef3021650 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg @@ -16,6 +16,8 @@ width="666" height="1366" viewBox="-100 -50 666 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor + + diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg index 40e95fbe8..a97665af9 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg @@ -16,6 +16,11 @@ width="1285" height="1868" viewBox="-100 -50 1285 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response + + + + + diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg index 40e95fbe8..a97665af9 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg @@ -16,6 +16,11 @@ width="1285" height="1868" viewBox="-100 -50 1285 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response + + + + + diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg index 062ed1eed..e563e1df0 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg @@ -16,6 +16,12 @@ width="1593" height="2146" viewBox="-100 -50 1593 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg index 062ed1eed..e563e1df0 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg @@ -16,6 +16,12 @@ width="1593" height="2146" viewBox="-100 -50 1593 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg index 5c7e8ffd3..3ac4ca8e0 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg @@ -16,6 +16,31 @@ width="3244" height="4173" viewBox="-100 -100 3244 4173">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg index c37e331bd..7a94dcd5f 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg @@ -16,6 +16,31 @@ width="3166" height="4293" viewBox="-88 -88 3166 4293">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + + + + + + + + + + + + + diff --git a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg index 0ccdd04b2..f66617f27 100644 --- a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg @@ -18,7 +18,11 @@ width="371" height="580" viewBox="-100 -100 371 580">acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc + + + + + + + + + + + + + + + + + + + + + + + + + + +acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc + + + + + + + + + + + + + + + + + + + + + + + + + + + -cube -cubeAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTND + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +AKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTND + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +containerfirstsecond 1->2c->2 + + + containerfirstsecond 1->2c->2 + + + ninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneight + + + + + + +ninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneight + + + + + + +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one + + + + + diff --git a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg index 0a92d5cc1..8e20cfbee 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg @@ -16,6 +16,11 @@ width="789" height="2014" viewBox="-39 -88 789 2014">eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one + + + + + diff --git a/e2etests/testdata/todo/tall_edge_label/dagre/sketch.exp.svg b/e2etests/testdata/todo/tall_edge_label/dagre/sketch.exp.svg index 9077c2058..ba3e7b43e 100644 --- a/e2etests/testdata/todo/tall_edge_label/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/tall_edge_label/dagre/sketch.exp.svg @@ -16,6 +16,8 @@ width="313" height="552" viewBox="-100 -100 313 552">ab Thereoncewasaverytalledgelabel + + ab Thereoncewasaverytalledgelabel + +