diff --git a/d2exporter/export.go b/d2exporter/export.go index 2f8e5ec40..c65542362 100644 --- a/d2exporter/export.go +++ b/d2exporter/export.go @@ -99,6 +99,11 @@ func toShape(obj *d2graph.Object, theme *d2themes.Theme) d2target.Shape { shape.Italic = text.IsItalic shape.FontSize = text.FontSize + if obj.IsSequenceDiagramGroup() { + shape.StrokeWidth = 0 + shape.Blend = true + } + applyStyles(shape, obj) applyTheme(shape, obj, theme) shape.Color = text.GetColor(theme, shape.Italic) diff --git a/d2graph/d2graph.go b/d2graph/d2graph.go index e560946f9..8b5f7003e 100644 --- a/d2graph/d2graph.go +++ b/d2graph/d2graph.go @@ -331,18 +331,12 @@ func (l ContainerLevel) LabelSize() int { func (obj *Object) GetFill(theme *d2themes.Theme) string { level := int(obj.Level()) - if obj.Parent.IsSequenceDiagram() { - return theme.Colors.B5 - } else if obj.IsSequenceDiagramNote() { + if obj.IsSequenceDiagramNote() { return theme.Colors.Neutrals.N7 } else if obj.IsSequenceDiagramGroup() { - sd := obj.OuterSequenceDiagram() - // Alternate - if (level-int(sd.Level()))%2 == 0 { - return theme.Colors.Neutrals.N7 - } else { - return theme.Colors.Neutrals.N6 - } + return theme.Colors.Neutrals.N5 + } else if obj.Parent.IsSequenceDiagram() { + return theme.Colors.B5 } shape := obj.Attributes.Shape.Value diff --git a/d2graph/seqdiagram.go b/d2graph/seqdiagram.go index bc40d387b..a92cc8924 100644 --- a/d2graph/seqdiagram.go +++ b/d2graph/seqdiagram.go @@ -33,7 +33,7 @@ func (obj *Object) IsSequenceDiagramGroup() bool { return false } } - return true + return obj.ContainsAnyObject(obj.Graph.Objects) || obj.ContainsAnyEdge(obj.Graph.Edges) } // notes are descendant of actors with no edges and no children @@ -41,7 +41,7 @@ func (obj *Object) IsSequenceDiagramNote() bool { if obj.OuterSequenceDiagram() == nil { return false } - return !obj.hasEdgeRef() && !obj.ContainsAnyEdge(obj.Graph.Edges) && len(obj.ChildrenArray) == 0 + return !obj.hasEdgeRef() && !obj.ContainsAnyEdge(obj.Graph.Edges) && len(obj.ChildrenArray) == 0 && !obj.ContainsAnyObject(obj.Graph.Objects) } func (obj *Object) hasEdgeRef() bool { @@ -54,6 +54,28 @@ func (obj *Object) hasEdgeRef() bool { return false } +func (obj *Object) ContainsAnyObject(objects []*Object) bool { + for _, o := range objects { + if o.ContainedBy(obj) { + return true + } + } + return false +} + +func (o *Object) ContainedBy(obj *Object) bool { + for _, ref := range o.References { + curr := ref.UnresolvedScopeObj + for curr != nil { + if curr == obj { + return true + } + curr = curr.Parent + } + } + return false +} + func (obj *Object) ContainsAnyEdge(edges []*Edge) bool { for _, e := range edges { if e.ContainedBy(obj) { diff --git a/d2layouts/d2sequence/constants.go b/d2layouts/d2sequence/constants.go index 07a8c2ff1..95de80681 100644 --- a/d2layouts/d2sequence/constants.go +++ b/d2layouts/d2sequence/constants.go @@ -36,9 +36,9 @@ const LIFELINE_STROKE_DASH int = 6 const LIFELINE_LABEL_PAD = 5. const ( - GROUP_Z_INDEX = 1 - LIFELINE_Z_INDEX = 2 - SPAN_Z_INDEX = 3 + LIFELINE_Z_INDEX = 1 + SPAN_Z_INDEX = 2 + GROUP_Z_INDEX = 3 MESSAGE_Z_INDEX = 4 NOTE_Z_INDEX = 5 ) diff --git a/d2renderers/d2svg/d2svg.go b/d2renderers/d2svg/d2svg.go index e46a0fb79..6bf9135a9 100644 --- a/d2renderers/d2svg/d2svg.go +++ b/d2renderers/d2svg/d2svg.go @@ -604,7 +604,12 @@ func drawShape(writer io.Writer, targetShape d2target.Shape) error { } } - fmt.Fprintf(writer, ``, shadowAttr) + var blendModeClass string + if targetShape.Blend { + blendModeClass = " blend" + } + + fmt.Fprintf(writer, ``, blendModeClass, shadowAttr) var multipleTL *geo.Point if targetShape.Multiple { diff --git a/d2renderers/d2svg/style.css b/d2renderers/d2svg/style.css index f5cffa9cc..2476c6ae7 100644 --- a/d2renderers/d2svg/style.css +++ b/d2renderers/d2svg/style.css @@ -6,3 +6,7 @@ stroke-linecap: round; stroke-linejoin: round; } +.blend { + mix-blend-mode: multiply; + opacity: 0.5; +} diff --git a/d2target/d2target.go b/d2target/d2target.go index 9c2dd2c9b..f8c0ff0cc 100644 --- a/d2target/d2target.go +++ b/d2target/d2target.go @@ -111,6 +111,10 @@ type Shape struct { Icon *url.URL `json:"icon"` IconPosition string `json:"iconPosition"` + // Whether the shape should allow shapes behind it to bleed through + // Currently just used for sequence diagram groups + Blend bool `json:"blend"` + Class SQLTable diff --git a/d2themes/d2themes.go b/d2themes/d2themes.go index 64510eb2f..3cd9f5830 100644 --- a/d2themes/d2themes.go +++ b/d2themes/d2themes.go @@ -44,7 +44,7 @@ var CoolNeutral = Neutral{ N2: "#676C7E", N3: "#9499AB", N4: "#CFD2DD", - N5: "#F0F3F9", + N5: "#DEE1EB", N6: "#EEF1F8", N7: "#FFFFFF", } diff --git a/e2etests/stable_test.go b/e2etests/stable_test.go index a7c0bc80a..22d6b86ec 100644 --- a/e2etests/stable_test.go +++ b/e2etests/stable_test.go @@ -1383,6 +1383,47 @@ group b: { choo: { _.d."this note" } +`, + }, + { + name: "sequence_diagram_nested_groups", + script: `shape: sequence_diagram + +this is a message group: { + _.a -> _.b + and this is a nested message group: { + _._.a -> _._.b + what about more nesting: { + _._._.a -> _._._.b + crazy town: { + _._._._.a."a note" + _._._._.a -> _._._._.b + whoa: { + _._._._._.a -> _._._._._.b + } + } + } + } +} + +alt: { + case 1: { + _._.b -> _._.c + } + case 2: { + _._.b -> _._.c + } + case 3: { + _._.b -> _._.c + } + case 4: { + _._.b -> _._.c + } +} + +b.note: "a note here to remember that padding must consider notes too" +a.note: "just\na\nlong\nnote\nhere" +c: "just an actor" `, }, { diff --git a/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json b/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json index 7649f1aa0..53c443478 100644 --- a/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json +++ b/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg b/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg index 8e0b6bde3..d38113b44 100644 --- a/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg +++ b/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="486" height="552" viewBox="-100 -100 486 552">abc abc ab ab acbd acbd ab hello diff --git a/e2etests/testdata/sanity/connection_label/elk/board.exp.json b/e2etests/testdata/sanity/connection_label/elk/board.exp.json index 2680db2b1..be654cbef 100644 --- a/e2etests/testdata/sanity/connection_label/elk/board.exp.json +++ b/e2etests/testdata/sanity/connection_label/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/sanity/connection_label/elk/sketch.exp.svg b/e2etests/testdata/sanity/connection_label/elk/sketch.exp.svg index 72194bada..2c8181f9a 100644 --- a/e2etests/testdata/sanity/connection_label/elk/sketch.exp.svg +++ b/e2etests/testdata/sanity/connection_label/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="313" height="673" viewBox="-88 -88 313 673">ab hello diff --git a/e2etests/testdata/sanity/empty/dagre/sketch.exp.svg b/e2etests/testdata/sanity/empty/dagre/sketch.exp.svg index 5c521366b..0ca3e31ac 100644 --- a/e2etests/testdata/sanity/empty/dagre/sketch.exp.svg +++ b/e2etests/testdata/sanity/empty/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="202" height="202" viewBox="9223372036854775707 9223372036854775707 202 20 stroke-linecap: round; stroke-linejoin: round; } +.blend { + mix-blend-mode: multiply; + opacity: 0.5; +} ]]> \ No newline at end of file diff --git a/e2etests/testdata/sanity/empty/elk/sketch.exp.svg b/e2etests/testdata/sanity/empty/elk/sketch.exp.svg index 5c521366b..0ca3e31ac 100644 --- a/e2etests/testdata/sanity/empty/elk/sketch.exp.svg +++ b/e2etests/testdata/sanity/empty/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="202" height="202" viewBox="9223372036854775707 9223372036854775707 202 20 stroke-linecap: round; stroke-linejoin: round; } +.blend { + mix-blend-mode: multiply; + opacity: 0.5; +} ]]> \ No newline at end of file diff --git a/e2etests/testdata/stable/all_shapes/dagre/board.exp.json b/e2etests/testdata/stable/all_shapes/dagre/board.exp.json index a86e092db..a740208e5 100644 --- a/e2etests/testdata/stable/all_shapes/dagre/board.exp.json +++ b/e2etests/testdata/stable/all_shapes/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -131,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F0F3F9", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -248,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F0F3F9", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -452,6 +463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -491,6 +503,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -530,6 +543,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -569,6 +583,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -599,7 +614,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F0F3F9", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -608,6 +623,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -647,6 +663,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/all_shapes/dagre/sketch.exp.svg b/e2etests/testdata/stable/all_shapes/dagre/sketch.exp.svg index 43a253d77..4e9cbf8bc 100644 --- a/e2etests/testdata/stable/all_shapes/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/all_shapes/dagre/sketch.exp.svg @@ -12,9 +12,13 @@ width="1539" height="824" viewBox="-100 -100 1539 824">rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud @@ -22,7 +26,7 @@ width="1539" height="824" viewBox="-100 -100 1539 824"> @@ -22,7 +26,7 @@ width="1352" height="824" viewBox="-88 -88 1352 824">cba * cba * ab To err is human, to moo bovine1* diff --git a/e2etests/testdata/stable/arrowhead_labels/elk/board.exp.json b/e2etests/testdata/stable/arrowhead_labels/elk/board.exp.json index 648d83fc8..97667ccc4 100644 --- a/e2etests/testdata/stable/arrowhead_labels/elk/board.exp.json +++ b/e2etests/testdata/stable/arrowhead_labels/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/arrowhead_labels/elk/sketch.exp.svg b/e2etests/testdata/stable/arrowhead_labels/elk/sketch.exp.svg index b2cd02bfb..0021a9490 100644 --- a/e2etests/testdata/stable/arrowhead_labels/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/arrowhead_labels/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="401" height="673" viewBox="14 -88 401 673">ab To err is human, to moo bovine1* diff --git a/e2etests/testdata/stable/binary_tree/dagre/board.exp.json b/e2etests/testdata/stable/binary_tree/dagre/board.exp.json index 92781dc2d..a8a2e2377 100644 --- a/e2etests/testdata/stable/binary_tree/dagre/board.exp.json +++ b/e2etests/testdata/stable/binary_tree/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -452,6 +463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -491,6 +503,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -530,6 +543,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -569,6 +583,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/binary_tree/dagre/sketch.exp.svg b/e2etests/testdata/stable/binary_tree/dagre/sketch.exp.svg index 4dc067779..99e24560c 100644 --- a/e2etests/testdata/stable/binary_tree/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/binary_tree/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="1518" height="1004" viewBox="-100 -100 1518 1004">abcdefghijklmno abcdefghijklmno aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos1/elk/board.exp.json b/e2etests/testdata/stable/chaos1/elk/board.exp.json index a8b4d6e22..d7fcac07d 100644 --- a/e2etests/testdata/stable/chaos1/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos1/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg index d1d227fe1..62b3bffda 100644 --- a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="630" height="869" viewBox="-88 -88 630 869">aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos2/dagre/board.exp.json b/e2etests/testdata/stable/chaos2/dagre/board.exp.json index 04707eae5..c928b6a24 100644 --- a/e2etests/testdata/stable/chaos2/dagre/board.exp.json +++ b/e2etests/testdata/stable/chaos2/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -217,6 +222,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -256,6 +262,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -294,6 +301,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -333,6 +341,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -372,6 +381,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -411,6 +421,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -450,6 +461,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -489,6 +501,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -528,6 +541,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -566,6 +580,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg index 1e18f39e6..06d891441 100644 --- a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="1317" height="1854" viewBox="-100 -100 1317 1854">abcd abcd abc abc BatchManager- diff --git a/e2etests/testdata/stable/class/elk/board.exp.json b/e2etests/testdata/stable/class/elk/board.exp.json index 67427ed80..85549a957 100644 --- a/e2etests/testdata/stable/class/elk/board.exp.json +++ b/e2etests/testdata/stable/class/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": [ { "name": "num", diff --git a/e2etests/testdata/stable/class/elk/sketch.exp.svg b/e2etests/testdata/stable/class/elk/sketch.exp.svg index d8ed26ffe..d1ad09c80 100644 --- a/e2etests/testdata/stable/class/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/class/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="539" height="568" viewBox="-88 -88 539 568">BatchManager- diff --git a/e2etests/testdata/stable/code_snippet/dagre/board.exp.json b/e2etests/testdata/stable/code_snippet/dagre/board.exp.json index 6cd1e4202..c058364e1 100644 --- a/e2etests/testdata/stable/code_snippet/dagre/board.exp.json +++ b/e2etests/testdata/stable/code_snippet/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -61,6 +62,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -100,6 +102,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/code_snippet/dagre/sketch.exp.svg b/e2etests/testdata/stable/code_snippet/dagre/sketch.exp.svg index 5594e9403..d0f72c05b 100644 --- a/e2etests/testdata/stable/code_snippet/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/code_snippet/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="955" height="818" viewBox="-100 -100 955 818">// RegisterHash registers a function that returns a new instance of the given diff --git a/e2etests/testdata/stable/code_snippet/elk/board.exp.json b/e2etests/testdata/stable/code_snippet/elk/board.exp.json index b8f8d107a..0004dd714 100644 --- a/e2etests/testdata/stable/code_snippet/elk/board.exp.json +++ b/e2etests/testdata/stable/code_snippet/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -61,6 +62,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -100,6 +102,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/code_snippet/elk/sketch.exp.svg b/e2etests/testdata/stable/code_snippet/elk/sketch.exp.svg index 9656a4a1d..32886df43 100644 --- a/e2etests/testdata/stable/code_snippet/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/code_snippet/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="955" height="818" viewBox="-88 -88 955 818">// RegisterHash registers a function that returns a new instance of the given diff --git a/e2etests/testdata/stable/connected_container/dagre/board.exp.json b/e2etests/testdata/stable/connected_container/dagre/board.exp.json index a3f8f7a7d..f16c21da4 100644 --- a/e2etests/testdata/stable/connected_container/dagre/board.exp.json +++ b/e2etests/testdata/stable/connected_container/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/connected_container/dagre/sketch.exp.svg b/e2etests/testdata/stable/connected_container/dagre/sketch.exp.svg index 7e3ba639a..c8660184a 100644 --- a/e2etests/testdata/stable/connected_container/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/connected_container/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="494" height="1178" viewBox="-100 -100 494 1178">acfbdhg acfbdhg agdfbhec agdfbhec abcdefghijklmnopq abcdefghijklmnopq finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot bacde21345abcde bacde21345abcde alphabeta gamma diff --git a/e2etests/testdata/stable/font_colors/elk/board.exp.json b/e2etests/testdata/stable/font_colors/elk/board.exp.json index 2766ed834..c7cbbba18 100644 --- a/e2etests/testdata/stable/font_colors/elk/board.exp.json +++ b/e2etests/testdata/stable/font_colors/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/font_colors/elk/sketch.exp.svg b/e2etests/testdata/stable/font_colors/elk/sketch.exp.svg index bdda7137b..0de53302e 100644 --- a/e2etests/testdata/stable/font_colors/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/font_colors/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="345" height="673" viewBox="-88 -88 345 673">alphabeta gamma diff --git a/e2etests/testdata/stable/font_sizes/dagre/board.exp.json b/e2etests/testdata/stable/font_sizes/dagre/board.exp.json index 8550c2c31..3a91ea14e 100644 --- a/e2etests/testdata/stable/font_sizes/dagre/board.exp.json +++ b/e2etests/testdata/stable/font_sizes/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -452,6 +463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/font_sizes/dagre/sketch.exp.svg b/e2etests/testdata/stable/font_sizes/dagre/sketch.exp.svg index b3a5e27e9..5a3a34239 100644 --- a/e2etests/testdata/stable/font_sizes/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/font_sizes/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="2360" height="632" viewBox="-100 -100 2360 632">size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/font_sizes/elk/board.exp.json b/e2etests/testdata/stable/font_sizes/elk/board.exp.json index 2fcb8f721..2d5446e61 100644 --- a/e2etests/testdata/stable/font_sizes/elk/board.exp.json +++ b/e2etests/testdata/stable/font_sizes/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -452,6 +463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg index c69206fcb..02055f08d 100644 --- a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="1965" height="793" viewBox="-88 -88 1965 793">size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json index 4d1de50b6..62256201b 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -61,6 +62,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -100,6 +102,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg index aa40b0cde..91b32cb2e 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="3251" height="5500" viewBox="-100 -100 3251 5500">hellohelloab ab aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/investigate/elk/board.exp.json b/e2etests/testdata/stable/investigate/elk/board.exp.json index 8f9f4f4bf..6e983b96d 100644 --- a/e2etests/testdata/stable/investigate/elk/board.exp.json +++ b/e2etests/testdata/stable/investigate/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -443,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F0F3F9", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -463,6 +474,7 @@ "RawFragment": "" }, "iconPosition": "INSIDE_MIDDLE_CENTER", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -502,6 +514,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -532,7 +545,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F0F3F9", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -552,6 +565,7 @@ "RawFragment": "" }, "iconPosition": "INSIDE_MIDDLE_CENTER", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -591,6 +605,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -630,6 +645,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -669,6 +685,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -708,6 +725,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -747,6 +765,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -786,6 +805,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -825,6 +845,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -864,6 +885,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -903,6 +925,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -942,6 +965,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -981,6 +1005,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1020,6 +1045,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1059,6 +1085,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1098,6 +1125,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1137,6 +1165,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1176,6 +1205,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1215,6 +1245,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg index cd4553a99..6655cd820 100644 --- a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg @@ -12,9 +12,13 @@ width="860" height="4868" viewBox="-82 -88 860 4868">aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/large_arch/dagre/board.exp.json b/e2etests/testdata/stable/large_arch/dagre/board.exp.json index 9d3b17eff..f62e8f5a5 100644 --- a/e2etests/testdata/stable/large_arch/dagre/board.exp.json +++ b/e2etests/testdata/stable/large_arch/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -452,6 +463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -491,6 +503,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -530,6 +543,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -569,6 +583,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -608,6 +623,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -647,6 +663,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -686,6 +703,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -725,6 +743,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -764,6 +783,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -803,6 +823,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -842,6 +863,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -881,6 +903,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -920,6 +943,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -959,6 +983,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -998,6 +1023,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1037,6 +1063,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1076,6 +1103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1115,6 +1143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1154,6 +1183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1193,6 +1223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1232,6 +1263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1271,6 +1303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg index ee5c062cc..13eab90b5 100644 --- a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="3244" height="1780" viewBox="-100 -100 3244 1780">abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv thisgoesmultiple linesthisgoesmultiple linesabcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstu abcdefghijklmnopqrstu Foo Baz12hello Foo Baz12hello acdefgbh acdefgbh topabcbottomstartend topabcbottomstartend xyz hello diff --git a/e2etests/testdata/stable/self-referencing/elk/board.exp.json b/e2etests/testdata/stable/self-referencing/elk/board.exp.json index 8ea3dd21a..36e35e83d 100644 --- a/e2etests/testdata/stable/self-referencing/elk/board.exp.json +++ b/e2etests/testdata/stable/self-referencing/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/self-referencing/elk/sketch.exp.svg b/e2etests/testdata/stable/self-referencing/elk/sketch.exp.svg index 058ea980c..fc638568c 100644 --- a/e2etests/testdata/stable/self-referencing/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/self-referencing/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="572" height="552" viewBox="-70 -88 572 552">xyz hello diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/board.exp.json index 9af65f933..775f8b93e 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -508,7 +514,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(c -- )[0]", @@ -547,7 +553,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(d -- )[0]", @@ -586,7 +592,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(e -- )[0]", @@ -625,7 +631,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(b -- )[0]", @@ -664,7 +670,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(f -- )[0]", @@ -703,7 +709,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/sketch.exp.svg index 1cb50d46f..a2518e2ba 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="2692" height="1396" viewBox="-100 -50 2692 1396">an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json index 9af65f933..775f8b93e 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -508,7 +514,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(c -- )[0]", @@ -547,7 +553,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(d -- )[0]", @@ -586,7 +592,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(e -- )[0]", @@ -625,7 +631,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(b -- )[0]", @@ -664,7 +670,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(f -- )[0]", @@ -703,7 +709,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg index 1cb50d46f..a2518e2ba 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="2692" height="1396" viewBox="-100 -50 2692 1396">an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json index 07560b349..8e0bfe6a8 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": [ { @@ -151,6 +154,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -190,6 +194,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -229,6 +234,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -268,6 +274,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -307,6 +314,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -346,6 +354,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -396,6 +405,7 @@ "RawFragment": "" }, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -435,6 +445,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -474,6 +485,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -513,6 +525,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -552,6 +565,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -591,6 +605,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -630,6 +645,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -669,6 +685,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -708,6 +725,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -747,6 +765,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -786,6 +805,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ @@ -1596,7 +1616,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(b -- )[0]", @@ -1635,7 +1655,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(c -- )[0]", @@ -1674,7 +1694,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(d -- )[0]", @@ -1713,7 +1733,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(e -- )[0]", @@ -1752,7 +1772,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(f -- )[0]", @@ -1791,7 +1811,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(g -- )[0]", @@ -1830,7 +1850,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(h -- )[0]", @@ -1869,7 +1889,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(i -- )[0]", @@ -1908,7 +1928,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(j -- )[0]", @@ -1947,7 +1967,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(k -- )[0]", @@ -1986,7 +2006,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(l -- )[0]", @@ -2025,7 +2045,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(m -- )[0]", @@ -2064,7 +2084,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(n -- )[0]", @@ -2103,7 +2123,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(o -- )[0]", @@ -2142,7 +2162,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(p -- )[0]", @@ -2181,7 +2201,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(q -- )[0]", @@ -2220,7 +2240,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(r -- )[0]", @@ -2259,7 +2279,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(s -- )[0]", @@ -2298,7 +2318,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(t -- )[0]", @@ -2337,7 +2357,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg index 6b0b0a3d0..ed0985a85 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="5145" height="2984" viewBox="-100 -50 5145 2984">a labelblabelsa class+ diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json index 07560b349..8e0bfe6a8 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": [ { @@ -151,6 +154,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -190,6 +194,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -229,6 +234,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -268,6 +274,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -307,6 +314,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -346,6 +354,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -396,6 +405,7 @@ "RawFragment": "" }, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -435,6 +445,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -474,6 +485,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -513,6 +525,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -552,6 +565,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -591,6 +605,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -630,6 +645,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -669,6 +685,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -708,6 +725,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -747,6 +765,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -786,6 +805,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ @@ -1596,7 +1616,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(b -- )[0]", @@ -1635,7 +1655,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(c -- )[0]", @@ -1674,7 +1694,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(d -- )[0]", @@ -1713,7 +1733,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(e -- )[0]", @@ -1752,7 +1772,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(f -- )[0]", @@ -1791,7 +1811,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(g -- )[0]", @@ -1830,7 +1850,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(h -- )[0]", @@ -1869,7 +1889,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(i -- )[0]", @@ -1908,7 +1928,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(j -- )[0]", @@ -1947,7 +1967,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(k -- )[0]", @@ -1986,7 +2006,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(l -- )[0]", @@ -2025,7 +2045,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(m -- )[0]", @@ -2064,7 +2084,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(n -- )[0]", @@ -2103,7 +2123,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(o -- )[0]", @@ -2142,7 +2162,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(p -- )[0]", @@ -2181,7 +2201,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(q -- )[0]", @@ -2220,7 +2240,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(r -- )[0]", @@ -2259,7 +2279,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(s -- )[0]", @@ -2298,7 +2318,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(t -- )[0]", @@ -2337,7 +2357,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg index 6b0b0a3d0..ed0985a85 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="5145" height="2984" viewBox="-100 -50 5145 2984">a labelblabelsa class+ diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json index a95c05f53..549e71e0c 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -168,9 +172,9 @@ "height": 80, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -192,7 +197,7 @@ "underline": false, "labelWidth": 30, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 1 }, { @@ -206,9 +211,9 @@ "height": 730, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -217,6 +222,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -230,7 +236,7 @@ "underline": false, "labelWidth": 57, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 1 }, { @@ -244,9 +250,9 @@ "height": 80, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -255,6 +261,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -268,7 +275,7 @@ "underline": false, "labelWidth": 78, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 2 }, { @@ -282,9 +289,9 @@ "height": 466, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -293,6 +300,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -306,7 +314,7 @@ "underline": false, "labelWidth": 58, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 1 }, { @@ -331,6 +339,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -359,9 +368,9 @@ "height": 216, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -370,6 +379,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -383,7 +393,7 @@ "underline": false, "labelWidth": 38, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 1 }, { @@ -408,6 +418,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -447,6 +458,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -460,7 +472,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -485,6 +497,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -498,7 +511,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -523,6 +536,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -536,7 +550,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 } ], @@ -968,7 +982,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(b -- )[0]", @@ -1007,7 +1021,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(c -- )[0]", @@ -1046,7 +1060,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(d -- )[0]", @@ -1085,7 +1099,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg index fa76e8cdf..dbca1fa1e 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg @@ -12,9 +12,13 @@ width="1147" height="2268" viewBox="-100 -50 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json index a95c05f53..549e71e0c 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -168,9 +172,9 @@ "height": 80, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -192,7 +197,7 @@ "underline": false, "labelWidth": 30, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 1 }, { @@ -206,9 +211,9 @@ "height": 730, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -217,6 +222,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -230,7 +236,7 @@ "underline": false, "labelWidth": 57, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 1 }, { @@ -244,9 +250,9 @@ "height": 80, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -255,6 +261,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -268,7 +275,7 @@ "underline": false, "labelWidth": 78, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 2 }, { @@ -282,9 +289,9 @@ "height": 466, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -293,6 +300,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -306,7 +314,7 @@ "underline": false, "labelWidth": 58, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 1 }, { @@ -331,6 +339,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -359,9 +368,9 @@ "height": 216, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -370,6 +379,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -383,7 +393,7 @@ "underline": false, "labelWidth": 38, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 1 }, { @@ -408,6 +418,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -447,6 +458,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -460,7 +472,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -485,6 +497,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -498,7 +511,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -523,6 +536,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -536,7 +550,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 } ], @@ -968,7 +982,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(b -- )[0]", @@ -1007,7 +1021,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(c -- )[0]", @@ -1046,7 +1060,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(d -- )[0]", @@ -1085,7 +1099,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg index fa76e8cdf..dbca1fa1e 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg @@ -12,9 +12,13 @@ width="1147" height="2268" viewBox="-100 -50 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json index 2e66a4eb8..c34da0a7d 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -235,7 +239,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a -- )[0]", @@ -274,7 +278,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg index d73943b18..2f7c49368 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="850" height="1162" viewBox="-287 -50 850 1162">ba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehere \ No newline at end of file diff --git a/e2etests/testdata/stable/sequence_diagram_nested_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_nested_groups/elk/board.exp.json new file mode 100644 index 000000000..fee70ce79 --- /dev/null +++ b/e2etests/testdata/stable/sequence_diagram_nested_groups/elk/board.exp.json @@ -0,0 +1,1105 @@ +{ + "name": "", + "shapes": [ + { + "id": "this is a message group", + "type": "", + "pos": { + "x": -121, + "y": 266 + }, + "width": 592, + "height": 952, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "this is a message group", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 160, + "labelHeight": 26, + "zIndex": 3, + "level": 1 + }, + { + "id": "this is a message group.and this is a nested message group", + "type": "", + "pos": { + "x": -97, + "y": 396 + }, + "width": 544, + "height": 798, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "and this is a nested message group", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 238, + "labelHeight": 26, + "zIndex": 3, + "level": 2 + }, + { + "id": "this is a message group.and this is a nested message group.what about more nesting", + "type": "", + "pos": { + "x": -73, + "y": 526 + }, + "width": 496, + "height": 644, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "what about more nesting", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 173, + "labelHeight": 26, + "zIndex": 3, + "level": 3 + }, + { + "id": "this is a message group.and this is a nested message group.what about more nesting.crazy town", + "type": "", + "pos": { + "x": -49, + "y": 656 + }, + "width": 448, + "height": 490, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "crazy town", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 77, + "labelHeight": 26, + "zIndex": 3, + "level": 4 + }, + { + "id": "a", + "type": "", + "pos": { + "x": 0, + "y": 50 + }, + "width": 150, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#EDF0FD", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "a", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 12, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + }, + { + "id": "a.a note", + "type": "rectangle", + "pos": { + "x": 1, + "y": 696 + }, + "width": 148, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#FFFFFF", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "a note", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 48, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 5, + "level": 2 + }, + { + "id": "this is a message group.and this is a nested message group.what about more nesting.crazy town.whoa", + "type": "", + "pos": { + "x": 25, + "y": 1042 + }, + "width": 350, + "height": 80, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "whoa", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 41, + "labelHeight": 26, + "zIndex": 3, + "level": 5 + }, + { + "id": "alt", + "type": "", + "pos": { + "x": 251, + "y": 1148 + }, + "width": 461, + "height": 518, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "alt", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 24, + "labelHeight": 26, + "zIndex": 3, + "level": 1 + }, + { + "id": "alt.case 1", + "type": "", + "pos": { + "x": 275, + "y": 1172 + }, + "width": 413, + "height": 80, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "case 1", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 47, + "labelHeight": 26, + "zIndex": 3, + "level": 2 + }, + { + "id": "alt.case 2", + "type": "", + "pos": { + "x": 275, + "y": 1302 + }, + "width": 413, + "height": 80, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "case 2", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 47, + "labelHeight": 26, + "zIndex": 3, + "level": 2 + }, + { + "id": "alt.case 3", + "type": "", + "pos": { + "x": 275, + "y": 1432 + }, + "width": 413, + "height": 80, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "case 3", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 47, + "labelHeight": 26, + "zIndex": 3, + "level": 2 + }, + { + "id": "alt.case 4", + "type": "", + "pos": { + "x": 275, + "y": 1562 + }, + "width": 413, + "height": 80, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "case 4", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 47, + "labelHeight": 26, + "zIndex": 3, + "level": 2 + }, + { + "id": "b", + "type": "", + "pos": { + "x": 250, + "y": 50 + }, + "width": 150, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#EDF0FD", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "b", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 13, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + }, + { + "id": "b.note", + "type": "rectangle", + "pos": { + "x": 62, + "y": 2052 + }, + "width": 525, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#FFFFFF", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "a note here to remember that padding must consider notes too", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 425, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 5, + "level": 2 + }, + { + "id": "a.note", + "type": "rectangle", + "pos": { + "x": 6, + "y": 1732 + }, + "width": 137, + "height": 190, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#FFFFFF", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "just\na\nlong\nnote\nhere", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 37, + "labelHeight": 90, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 5, + "level": 2 + }, + { + "id": "c", + "type": "", + "pos": { + "x": 543, + "y": 50 + }, + "width": 190, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#EDF0FD", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "just an actor", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 90, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + } + ], + "connections": [ + { + "id": "(a -> b)[0]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 306 + }, + { + "x": 325, + "y": 306 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -> b)[1]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 436 + }, + { + "x": 325, + "y": 436 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -> b)[2]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 566 + }, + { + "x": 325, + "y": 566 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -> b)[3]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 952 + }, + { + "x": 325, + "y": 952 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -> b)[4]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 1082 + }, + { + "x": 325, + "y": 1082 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(b -> c)[0]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "c", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 325, + "y": 1212 + }, + { + "x": 638, + "y": 1212 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(b -> c)[1]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "c", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 325, + "y": 1342 + }, + { + "x": 638, + "y": 1342 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(b -> c)[2]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "c", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 325, + "y": 1472 + }, + { + "x": 638, + "y": 1472 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(b -> c)[3]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "c", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 325, + "y": 1602 + }, + { + "x": 638, + "y": 1602 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -- )[0]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "a-lifeline-end-2251863791", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 176 + }, + { + "x": 75, + "y": 2308 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 1 + }, + { + "id": "(b -- )[0]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "b-lifeline-end-668380428", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 325, + "y": 176 + }, + { + "x": 325, + "y": 2308 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 1 + }, + { + "id": "(c -- )[0]", + "src": "c", + "srcArrow": "none", + "srcLabel": "", + "dst": "c-lifeline-end-955173837", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 638, + "y": 176 + }, + { + "x": 638, + "y": 2308 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 1 + } + ] +} diff --git a/e2etests/testdata/stable/sequence_diagram_nested_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_nested_groups/elk/sketch.exp.svg new file mode 100644 index 000000000..d5d231a05 --- /dev/null +++ b/e2etests/testdata/stable/sequence_diagram_nested_groups/elk/sketch.exp.svg @@ -0,0 +1,28 @@ + +abjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehere \ No newline at end of file diff --git a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/board.exp.json index 4baf730fb..e62ba4e21 100644 --- a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -75,7 +77,7 @@ "underline": false, "labelWidth": 29, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -100,6 +102,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -139,6 +142,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -152,7 +156,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -177,6 +181,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -216,6 +221,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -229,7 +235,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -254,6 +260,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -267,7 +274,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -292,6 +299,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -331,6 +339,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -344,7 +353,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -369,6 +378,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -382,7 +392,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -407,6 +417,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -420,7 +431,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -445,6 +456,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -484,6 +496,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -497,7 +510,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -522,6 +535,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -535,7 +549,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -560,6 +574,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -573,7 +588,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -598,6 +613,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -611,7 +627,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -636,6 +652,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -675,6 +692,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -688,7 +706,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -713,6 +731,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -726,7 +745,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -751,6 +770,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -764,7 +784,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -789,6 +809,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -802,7 +823,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -827,6 +848,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -840,7 +862,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 6 }, { @@ -865,6 +887,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -878,7 +901,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 } ], @@ -1271,7 +1294,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(itemResponse -- )[0]", @@ -1310,7 +1333,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(item -- )[0]", @@ -1349,7 +1372,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(essayRubric -- )[0]", @@ -1388,7 +1411,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(concept -- )[0]", @@ -1427,7 +1450,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(itemOutcome -- )[0]", @@ -1466,7 +1489,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg index a35a7be98..230e610ff 100644 --- a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="1624" height="1626" viewBox="-100 -50 1624 1626">scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier diff --git a/e2etests/testdata/stable/sequence_diagram_note/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_note/elk/board.exp.json index bbf696e93..cb19b8bd7 100644 --- a/e2etests/testdata/stable/sequence_diagram_note/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_note/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -469,7 +477,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(b -- )[0]", @@ -508,7 +516,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(c -- )[0]", @@ -547,7 +555,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(d -- )[0]", @@ -586,7 +594,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_note/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_note/elk/sketch.exp.svg index dd18f9f8a..8fc76e2b3 100644 --- a/e2etests/testdata/stable/sequence_diagram_note/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_note/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="1328" height="1886" viewBox="-145 -50 1328 1886">abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier diff --git a/e2etests/testdata/stable/sequence_diagram_real/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/dagre/board.exp.json index 6d3d7abc7..2a3c01667 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_real/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -363,9 +372,9 @@ "height": 80, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -387,7 +397,7 @@ "underline": false, "labelWidth": 185, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 2 }, { @@ -412,6 +422,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -425,7 +436,7 @@ "underline": false, "labelWidth": 47, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -450,6 +461,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -489,6 +501,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -528,6 +541,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -541,7 +555,7 @@ "underline": false, "labelWidth": 50, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 } ], @@ -1090,7 +1104,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2ast -- )[0]", @@ -1129,7 +1143,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2compiler -- )[0]", @@ -1168,7 +1182,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2layout -- )[0]", @@ -1207,7 +1221,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2exporter -- )[0]", @@ -1246,7 +1260,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2themes -- )[0]", @@ -1285,7 +1299,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2renderer -- )[0]", @@ -1324,7 +1338,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2sequencelayout -- )[0]", @@ -1363,7 +1377,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2dagrelayout -- )[0]", @@ -1402,7 +1416,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_real/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/dagre/sketch.exp.svg index 4f2dd171b..b440cc17e 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_real/dagre/sketch.exp.svg @@ -12,9 +12,13 @@ width="2399" height="2488" viewBox="-100 -100 2399 2488">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json index fe58790d5..1c3fc272f 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -363,9 +372,9 @@ "height": 80, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -387,7 +397,7 @@ "underline": false, "labelWidth": 185, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 2 }, { @@ -412,6 +422,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -425,7 +436,7 @@ "underline": false, "labelWidth": 47, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -450,6 +461,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -489,6 +501,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -528,6 +541,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -541,7 +555,7 @@ "underline": false, "labelWidth": 50, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 } ], @@ -1090,7 +1104,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2ast -- )[0]", @@ -1129,7 +1143,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2compiler -- )[0]", @@ -1168,7 +1182,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2layout -- )[0]", @@ -1207,7 +1221,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2exporter -- )[0]", @@ -1246,7 +1260,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2themes -- )[0]", @@ -1285,7 +1299,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2renderer -- )[0]", @@ -1324,7 +1338,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2sequencelayout -- )[0]", @@ -1363,7 +1377,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2dagrelayout -- )[0]", @@ -1402,7 +1416,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg index e3290f479..cbdba47a0 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg @@ -12,9 +12,13 @@ width="2399" height="2488" viewBox="-88 -88 2399 2488">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json index f9354250f..a82ecfc32 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -114,7 +117,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -139,6 +142,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -152,7 +156,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -177,6 +181,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -190,7 +195,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -215,6 +220,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -228,7 +234,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -253,6 +259,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -266,7 +273,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 } ], @@ -613,7 +620,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(b -- )[0]", @@ -652,7 +659,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg index e7afe1e67..da4f56495 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="696" height="1366" viewBox="-100 -50 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json index f9354250f..a82ecfc32 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -114,7 +117,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -139,6 +142,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -152,7 +156,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -177,6 +181,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -190,7 +195,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -215,6 +220,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -228,7 +234,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -253,6 +259,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -266,7 +273,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 } ], @@ -613,7 +620,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(b -- )[0]", @@ -652,7 +659,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg index e7afe1e67..da4f56495 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="696" height="1366" viewBox="-100 -50 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json index 8c2499439..2309eba49 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -625,7 +630,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(bob -- )[0]", @@ -664,7 +669,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(db -- )[0]", @@ -703,7 +708,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(queue -- )[0]", @@ -742,7 +747,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(service -- )[0]", @@ -781,7 +786,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg index 86910940d..20d110d82 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="1589" height="1868" viewBox="-100 -50 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json index 8c2499439..2309eba49 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -625,7 +630,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(bob -- )[0]", @@ -664,7 +669,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(db -- )[0]", @@ -703,7 +708,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(queue -- )[0]", @@ -742,7 +747,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(service -- )[0]", @@ -781,7 +786,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg index 86910940d..20d110d82 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="1589" height="1868" viewBox="-100 -50 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json index 72d281eea..e91e7be35 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -75,7 +77,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -100,6 +102,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -139,6 +142,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -152,7 +156,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -177,6 +181,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -216,6 +221,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -229,7 +235,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -254,6 +260,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -293,6 +300,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -306,7 +314,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -331,6 +339,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -344,7 +353,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -369,6 +378,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -408,6 +418,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -421,7 +432,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -446,6 +457,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -485,6 +497,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -498,7 +511,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -523,6 +536,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -536,7 +550,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -561,6 +575,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -574,7 +589,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -599,6 +614,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -612,7 +628,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -637,6 +653,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -650,7 +667,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 } ], @@ -1199,7 +1216,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(itemResponse -- )[0]", @@ -1238,7 +1255,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(item -- )[0]", @@ -1277,7 +1294,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(essayRubric -- )[0]", @@ -1316,7 +1333,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(concept -- )[0]", @@ -1355,7 +1372,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(itemOutcome -- )[0]", @@ -1394,7 +1411,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg index b776d3c7d..f756c4475 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="1624" height="2146" viewBox="-100 -50 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json index 72d281eea..e91e7be35 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -75,7 +77,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -100,6 +102,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -139,6 +142,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -152,7 +156,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -177,6 +181,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -216,6 +221,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -229,7 +235,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -254,6 +260,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -293,6 +300,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -306,7 +314,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -331,6 +339,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -344,7 +353,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -369,6 +378,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -408,6 +418,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -421,7 +432,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -446,6 +457,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -485,6 +497,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -498,7 +511,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -523,6 +536,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -536,7 +550,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -561,6 +575,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -574,7 +589,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -599,6 +614,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -612,7 +628,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -637,6 +653,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -650,7 +667,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 } ], @@ -1199,7 +1216,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(itemResponse -- )[0]", @@ -1238,7 +1255,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(item -- )[0]", @@ -1277,7 +1294,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(essayRubric -- )[0]", @@ -1316,7 +1333,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(concept -- )[0]", @@ -1355,7 +1372,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(itemOutcome -- )[0]", @@ -1394,7 +1411,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg index b776d3c7d..f756c4475 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="1624" height="2146" viewBox="-100 -50 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json index c525922c8..e716f845f 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -170,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F0F3F9", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -452,6 +463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -491,6 +503,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -530,6 +543,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -543,7 +557,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -568,6 +582,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -607,6 +622,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -620,7 +636,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -645,6 +661,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -684,6 +701,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -697,7 +715,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -722,6 +740,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -761,6 +780,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -774,7 +794,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -799,6 +819,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -812,7 +833,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -837,6 +858,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -876,6 +898,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -889,7 +912,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -914,6 +937,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -953,6 +977,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -966,7 +991,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -991,6 +1016,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1004,7 +1030,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -1029,6 +1055,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1042,7 +1069,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -1067,6 +1094,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1080,7 +1108,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -1105,6 +1133,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1118,7 +1147,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -1143,6 +1172,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1182,6 +1212,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1195,7 +1226,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1220,6 +1251,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1259,6 +1291,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1272,7 +1305,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1297,6 +1330,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1336,6 +1370,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1349,7 +1384,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1374,6 +1409,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1413,6 +1449,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1426,7 +1463,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1451,6 +1488,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1464,7 +1502,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -1489,6 +1527,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1528,6 +1567,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1541,7 +1581,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1566,6 +1606,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1605,6 +1646,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1618,7 +1660,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1643,6 +1685,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1656,7 +1699,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1681,6 +1724,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1694,7 +1738,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1719,6 +1763,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1732,7 +1777,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1757,6 +1802,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1770,7 +1816,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1795,6 +1841,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1834,6 +1881,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1847,7 +1895,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1872,6 +1920,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1885,7 +1934,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1910,6 +1959,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1923,7 +1973,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -1948,6 +1998,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1961,7 +2012,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1986,6 +2037,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1999,7 +2051,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -2024,6 +2076,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2037,7 +2090,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 6 }, { @@ -2062,6 +2115,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2075,7 +2129,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -2100,6 +2154,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2113,7 +2168,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -2138,6 +2193,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2151,7 +2207,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 6 }, { @@ -2176,6 +2232,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2189,7 +2246,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 7 }, { @@ -2214,6 +2271,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2227,7 +2285,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -2252,6 +2310,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2265,7 +2324,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -2290,6 +2349,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2303,7 +2363,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 6 }, { @@ -2328,6 +2388,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2341,7 +2402,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 7 }, { @@ -2366,6 +2427,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2379,7 +2441,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 8 }, { @@ -2404,6 +2466,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2417,7 +2480,7 @@ "underline": false, "labelWidth": 29, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -2442,6 +2505,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2455,7 +2519,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 } ], @@ -4123,7 +4187,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.itemResponse -- )[0]", @@ -4162,7 +4226,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.item -- )[0]", @@ -4201,7 +4265,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.essayRubric -- )[0]", @@ -4240,7 +4304,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.concept -- )[0]", @@ -4279,7 +4343,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.itemOutcome -- )[0]", @@ -4318,7 +4382,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.scorer -- )[0]", @@ -4357,7 +4421,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.itemResponse -- )[0]", @@ -4396,7 +4460,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.item -- )[0]", @@ -4435,7 +4499,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.essayRubric -- )[0]", @@ -4474,7 +4538,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.concept -- )[0]", @@ -4513,7 +4577,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.itemOutcome -- )[0]", @@ -4552,7 +4616,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.scorer -- )[0]", @@ -4591,7 +4655,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.concept -- )[0]", @@ -4630,7 +4694,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.essayRubric -- )[0]", @@ -4669,7 +4733,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.item -- )[0]", @@ -4708,7 +4772,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.itemOutcome -- )[0]", @@ -4747,7 +4811,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.itemResponse -- )[0]", @@ -4786,7 +4850,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg index 59cd41e58..f0f099f66 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg @@ -12,9 +12,13 @@ width="3306" height="4173" viewBox="-100 -100 3306 4173">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json index fe9038e4c..853462bf3 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -170,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F0F3F9", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -452,6 +463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -491,6 +503,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -530,6 +543,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -543,7 +557,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -568,6 +582,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -607,6 +622,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -620,7 +636,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -645,6 +661,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -684,6 +701,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -697,7 +715,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -722,6 +740,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -761,6 +780,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -774,7 +794,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -799,6 +819,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -812,7 +833,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -837,6 +858,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -876,6 +898,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -889,7 +912,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -914,6 +937,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -953,6 +977,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -966,7 +991,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -991,6 +1016,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1004,7 +1030,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -1029,6 +1055,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1042,7 +1069,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -1067,6 +1094,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1080,7 +1108,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -1105,6 +1133,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1118,7 +1147,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -1143,6 +1172,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1182,6 +1212,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1195,7 +1226,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1220,6 +1251,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1259,6 +1291,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1272,7 +1305,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1297,6 +1330,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1336,6 +1370,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1349,7 +1384,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1374,6 +1409,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1413,6 +1449,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1426,7 +1463,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1451,6 +1488,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1464,7 +1502,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -1489,6 +1527,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1528,6 +1567,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1541,7 +1581,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1566,6 +1606,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1605,6 +1646,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1618,7 +1660,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1643,6 +1685,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1656,7 +1699,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1681,6 +1724,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1694,7 +1738,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1719,6 +1763,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1732,7 +1777,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1757,6 +1802,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1770,7 +1816,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1795,6 +1841,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1834,6 +1881,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1847,7 +1895,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1872,6 +1920,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1885,7 +1934,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1910,6 +1959,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1923,7 +1973,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -1948,6 +1998,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1961,7 +2012,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1986,6 +2037,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1999,7 +2051,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -2024,6 +2076,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2037,7 +2090,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 6 }, { @@ -2062,6 +2115,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2075,7 +2129,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -2100,6 +2154,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2113,7 +2168,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -2138,6 +2193,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2151,7 +2207,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 6 }, { @@ -2176,6 +2232,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2189,7 +2246,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 7 }, { @@ -2214,6 +2271,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2227,7 +2285,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -2252,6 +2310,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2265,7 +2324,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -2290,6 +2349,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2303,7 +2363,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 6 }, { @@ -2328,6 +2388,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2341,7 +2402,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 7 }, { @@ -2366,6 +2427,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2379,7 +2441,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 8 }, { @@ -2404,6 +2466,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2417,7 +2480,7 @@ "underline": false, "labelWidth": 29, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -2442,6 +2505,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2455,7 +2519,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 } ], @@ -4042,7 +4106,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.itemResponse -- )[0]", @@ -4081,7 +4145,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.item -- )[0]", @@ -4120,7 +4184,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.essayRubric -- )[0]", @@ -4159,7 +4223,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.concept -- )[0]", @@ -4198,7 +4262,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.itemOutcome -- )[0]", @@ -4237,7 +4301,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.scorer -- )[0]", @@ -4276,7 +4340,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.itemResponse -- )[0]", @@ -4315,7 +4379,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.item -- )[0]", @@ -4354,7 +4418,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.essayRubric -- )[0]", @@ -4393,7 +4457,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.concept -- )[0]", @@ -4432,7 +4496,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.itemOutcome -- )[0]", @@ -4471,7 +4535,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.scorer -- )[0]", @@ -4510,7 +4574,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.concept -- )[0]", @@ -4549,7 +4613,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.essayRubric -- )[0]", @@ -4588,7 +4652,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.item -- )[0]", @@ -4627,7 +4691,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.itemOutcome -- )[0]", @@ -4666,7 +4730,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.itemResponse -- )[0]", @@ -4705,7 +4769,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg index 91b4721cd..2b8e84882 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg @@ -12,9 +12,13 @@ width="3228" height="4293" viewBox="-88 -88 3228 4293">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sql_tables/dagre/board.exp.json b/e2etests/testdata/stable/sql_tables/dagre/board.exp.json index e4f5b8038..b6e0dfc1d 100644 --- a/e2etests/testdata/stable/sql_tables/dagre/board.exp.json +++ b/e2etests/testdata/stable/sql_tables/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ @@ -92,6 +93,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ @@ -155,6 +157,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ @@ -212,6 +215,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ diff --git a/e2etests/testdata/stable/sql_tables/dagre/sketch.exp.svg b/e2etests/testdata/stable/sql_tables/dagre/sketch.exp.svg index 38c496a68..cf84dfc73 100644 --- a/e2etests/testdata/stable/sql_tables/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sql_tables/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="1162" height="660" viewBox="-100 -100 1162 660">usersid diff --git a/e2etests/testdata/stable/sql_tables/elk/board.exp.json b/e2etests/testdata/stable/sql_tables/elk/board.exp.json index 4580c1251..2734f02ca 100644 --- a/e2etests/testdata/stable/sql_tables/elk/board.exp.json +++ b/e2etests/testdata/stable/sql_tables/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ @@ -92,6 +93,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ @@ -155,6 +157,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ @@ -212,6 +215,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ diff --git a/e2etests/testdata/stable/sql_tables/elk/sketch.exp.svg b/e2etests/testdata/stable/sql_tables/elk/sketch.exp.svg index 82f2f84a6..f1ca8409b 100644 --- a/e2etests/testdata/stable/sql_tables/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sql_tables/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="1082" height="660" viewBox="-88 -88 1082 660">usersid diff --git a/e2etests/testdata/stable/square_3d/dagre/board.exp.json b/e2etests/testdata/stable/square_3d/dagre/board.exp.json index 1271b3d7c..8a037500b 100644 --- a/e2etests/testdata/stable/square_3d/dagre/board.exp.json +++ b/e2etests/testdata/stable/square_3d/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg index 0ccdd04b2..834d15ac7 100644 --- a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="371" height="580" viewBox="-100 -100 371 580"> diff --git a/e2etests/testdata/stable/square_3d/elk/board.exp.json b/e2etests/testdata/stable/square_3d/elk/board.exp.json index e2493608c..e7bf89b84 100644 --- a/e2etests/testdata/stable/square_3d/elk/board.exp.json +++ b/e2etests/testdata/stable/square_3d/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/square_3d/elk/sketch.exp.svg b/e2etests/testdata/stable/square_3d/elk/sketch.exp.svg index 79cb89863..51c0cbe04 100644 --- a/e2etests/testdata/stable/square_3d/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/square_3d/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="371" height="580" viewBox="-88 -88 371 580"> diff --git a/e2etests/testdata/stable/straight_hierarchy_container/dagre/board.exp.json b/e2etests/testdata/stable/straight_hierarchy_container/dagre/board.exp.json index e08955990..00913a3e3 100644 --- a/e2etests/testdata/stable/straight_hierarchy_container/dagre/board.exp.json +++ b/e2etests/testdata/stable/straight_hierarchy_container/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -452,6 +463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -491,6 +503,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -530,6 +543,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -569,6 +583,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -608,6 +623,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -647,6 +663,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -686,6 +703,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -725,6 +743,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -764,6 +783,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -803,6 +823,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -842,6 +863,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -881,6 +903,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -920,6 +943,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -959,6 +983,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/straight_hierarchy_container/dagre/sketch.exp.svg b/e2etests/testdata/stable/straight_hierarchy_container/dagre/sketch.exp.svg index 1a5168cc1..fea7e02e7 100644 --- a/e2etests/testdata/stable/straight_hierarchy_container/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/straight_hierarchy_container/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="999" height="1730" viewBox="-100 -100 999 1730">acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc diff --git a/e2etests/testdata/stable/stylish/elk/board.exp.json b/e2etests/testdata/stable/stylish/elk/board.exp.json index 7df611198..0cd252c22 100644 --- a/e2etests/testdata/stable/stylish/elk/board.exp.json +++ b/e2etests/testdata/stable/stylish/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/stylish/elk/sketch.exp.svg b/e2etests/testdata/stable/stylish/elk/sketch.exp.svg index da08d2875..1668e14fd 100644 --- a/e2etests/testdata/stable/stylish/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/stylish/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="314" height="552" viewBox="-88 -88 314 552"> diff --git a/e2etests/testdata/stable/transparent_3d/dagre/board.exp.json b/e2etests/testdata/stable/transparent_3d/dagre/board.exp.json index f2de4f323..c19a78f8f 100644 --- a/e2etests/testdata/stable/transparent_3d/dagre/board.exp.json +++ b/e2etests/testdata/stable/transparent_3d/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/transparent_3d/dagre/sketch.exp.svg b/e2etests/testdata/stable/transparent_3d/dagre/sketch.exp.svg index 9fed45499..ab997d9a1 100644 --- a/e2etests/testdata/stable/transparent_3d/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/transparent_3d/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="339" height="326" viewBox="-100 -100 339 326"> diff --git a/e2etests/testdata/stable/transparent_3d/elk/board.exp.json b/e2etests/testdata/stable/transparent_3d/elk/board.exp.json index 41cb8cf6f..cbdf1ca4e 100644 --- a/e2etests/testdata/stable/transparent_3d/elk/board.exp.json +++ b/e2etests/testdata/stable/transparent_3d/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/transparent_3d/elk/sketch.exp.svg b/e2etests/testdata/stable/transparent_3d/elk/sketch.exp.svg index e5e521a73..a5dfd5e2a 100644 --- a/e2etests/testdata/stable/transparent_3d/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/transparent_3d/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="339" height="326" viewBox="-88 -88 339 326"> diff --git a/e2etests/testdata/stable/us_map/dagre/board.exp.json b/e2etests/testdata/stable/us_map/dagre/board.exp.json index b5ba0c1f4..6deece116 100644 --- a/e2etests/testdata/stable/us_map/dagre/board.exp.json +++ b/e2etests/testdata/stable/us_map/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -452,6 +463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -491,6 +503,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -530,6 +543,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -569,6 +583,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -608,6 +623,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -647,6 +663,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -686,6 +703,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -725,6 +743,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -764,6 +783,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -803,6 +823,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -842,6 +863,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -881,6 +903,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -920,6 +943,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -959,6 +983,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -998,6 +1023,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1037,6 +1063,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1076,6 +1103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1115,6 +1143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1154,6 +1183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1193,6 +1223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1232,6 +1263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1271,6 +1303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1310,6 +1343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1349,6 +1383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1388,6 +1423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1427,6 +1463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1466,6 +1503,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1505,6 +1543,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1544,6 +1583,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1583,6 +1623,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1622,6 +1663,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1661,6 +1703,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1700,6 +1743,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1739,6 +1783,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1778,6 +1823,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1817,6 +1863,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1856,6 +1903,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1895,6 +1943,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1934,6 +1983,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/us_map/dagre/sketch.exp.svg b/e2etests/testdata/stable/us_map/dagre/sketch.exp.svg index 3f27041e4..539986eb2 100644 --- a/e2etests/testdata/stable/us_map/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/us_map/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="3322" height="2812" viewBox="-100 -100 3322 2812">AKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDcontainerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json index 251a3afc2..35b0e5dd0 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json +++ b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg index 74e591fac..df3ac9c7a 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="536" height="663" viewBox="-88 -88 536 663">containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json index 3928b93ed..f3951de5d 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg index f3e3f7b1a..bf4b4f2b7 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg @@ -12,6 +12,10 @@ width="664" height="716" viewBox="-100 -100 664 716">ninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneighteightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json index 03661ef73..d012e76be 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg index 0a92d5cc1..c417a43f7 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="789" height="2014" viewBox="-39 -88 789 2014">eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json index 2a26b1e83..cf833fad1 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -129,9 +132,9 @@ "height": 696, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -153,7 +157,7 @@ "underline": false, "labelWidth": 160, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 1 }, { @@ -167,9 +171,9 @@ "height": 542, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -178,6 +182,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -191,7 +196,7 @@ "underline": false, "labelWidth": 238, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 2 }, { @@ -205,9 +210,9 @@ "height": 388, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -216,6 +221,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -229,7 +235,7 @@ "underline": false, "labelWidth": 173, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 3 }, { @@ -243,9 +249,9 @@ "height": 234, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,6 +260,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -267,7 +274,7 @@ "underline": false, "labelWidth": 21, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 4 }, { @@ -281,9 +288,9 @@ "height": 80, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -292,6 +299,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -305,7 +313,7 @@ "underline": false, "labelWidth": 21, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 5 } ], @@ -581,7 +589,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a -- )[0]", @@ -620,7 +628,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(c -- )[0]", @@ -659,7 +667,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg index 7663e9dd0..a50c69347 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg @@ -12,9 +12,13 @@ width="921" height="1242" viewBox="-171 -50 921 1242">bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo ab Thereoncewasaverytalledgelabel diff --git a/e2etests/testdata/todo/tall_edge_label/elk/board.exp.json b/e2etests/testdata/todo/tall_edge_label/elk/board.exp.json index 1d7e56a74..be7edc7f0 100644 --- a/e2etests/testdata/todo/tall_edge_label/elk/board.exp.json +++ b/e2etests/testdata/todo/tall_edge_label/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/todo/tall_edge_label/elk/sketch.exp.svg b/e2etests/testdata/todo/tall_edge_label/elk/sketch.exp.svg index b270e215c..23e6ddfba 100644 --- a/e2etests/testdata/todo/tall_edge_label/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/tall_edge_label/elk/sketch.exp.svg @@ -12,6 +12,10 @@ width="313" height="785" viewBox="-88 -88 313 785">ab Thereoncewasaverytalledgelabel diff --git a/testdata/d2exporter/TestExport/connection/arrowhead.exp.json b/testdata/d2exporter/TestExport/connection/arrowhead.exp.json index 60ac88668..09b26f2db 100644 --- a/testdata/d2exporter/TestExport/connection/arrowhead.exp.json +++ b/testdata/d2exporter/TestExport/connection/arrowhead.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -61,6 +62,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/testdata/d2exporter/TestExport/connection/basic.exp.json b/testdata/d2exporter/TestExport/connection/basic.exp.json index 726218c9c..50d65855d 100644 --- a/testdata/d2exporter/TestExport/connection/basic.exp.json +++ b/testdata/d2exporter/TestExport/connection/basic.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -61,6 +62,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/testdata/d2exporter/TestExport/connection/stroke-dash.exp.json b/testdata/d2exporter/TestExport/connection/stroke-dash.exp.json index 4d68e010d..aa483fe31 100644 --- a/testdata/d2exporter/TestExport/connection/stroke-dash.exp.json +++ b/testdata/d2exporter/TestExport/connection/stroke-dash.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -61,6 +62,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/testdata/d2exporter/TestExport/connection/theme_stroke-dash.exp.json b/testdata/d2exporter/TestExport/connection/theme_stroke-dash.exp.json index e97b648ac..d1add431f 100644 --- a/testdata/d2exporter/TestExport/connection/theme_stroke-dash.exp.json +++ b/testdata/d2exporter/TestExport/connection/theme_stroke-dash.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -61,6 +62,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/testdata/d2exporter/TestExport/label/basic_shape.exp.json b/testdata/d2exporter/TestExport/label/basic_shape.exp.json index 931fe4753..f017e35f5 100644 --- a/testdata/d2exporter/TestExport/label/basic_shape.exp.json +++ b/testdata/d2exporter/TestExport/label/basic_shape.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/testdata/d2exporter/TestExport/label/connection_font_color.exp.json b/testdata/d2exporter/TestExport/label/connection_font_color.exp.json index 748ca5390..62cf2719e 100644 --- a/testdata/d2exporter/TestExport/label/connection_font_color.exp.json +++ b/testdata/d2exporter/TestExport/label/connection_font_color.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -61,6 +62,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/testdata/d2exporter/TestExport/label/shape_font_color.exp.json b/testdata/d2exporter/TestExport/label/shape_font_color.exp.json index e0985129a..00b3d298e 100644 --- a/testdata/d2exporter/TestExport/label/shape_font_color.exp.json +++ b/testdata/d2exporter/TestExport/label/shape_font_color.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/testdata/d2exporter/TestExport/shape/basic.exp.json b/testdata/d2exporter/TestExport/shape/basic.exp.json index ec233aa08..226cbb94e 100644 --- a/testdata/d2exporter/TestExport/shape/basic.exp.json +++ b/testdata/d2exporter/TestExport/shape/basic.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/testdata/d2exporter/TestExport/shape/border-radius.exp.json b/testdata/d2exporter/TestExport/shape/border-radius.exp.json index 6b9a69075..0a934ec54 100644 --- a/testdata/d2exporter/TestExport/shape/border-radius.exp.json +++ b/testdata/d2exporter/TestExport/shape/border-radius.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/testdata/d2exporter/TestExport/shape/image_dimensions.exp.json b/testdata/d2exporter/TestExport/shape/image_dimensions.exp.json index f33f6473d..637bd91e8 100644 --- a/testdata/d2exporter/TestExport/shape/image_dimensions.exp.json +++ b/testdata/d2exporter/TestExport/shape/image_dimensions.exp.json @@ -34,6 +34,7 @@ "RawFragment": "" }, "iconPosition": "INSIDE_MIDDLE_CENTER", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/testdata/d2exporter/TestExport/shape/synonyms.exp.json b/testdata/d2exporter/TestExport/shape/synonyms.exp.json index b67ca940a..dc02f5a8f 100644 --- a/testdata/d2exporter/TestExport/shape/synonyms.exp.json +++ b/testdata/d2exporter/TestExport/shape/synonyms.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -61,6 +62,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/testdata/d2exporter/TestExport/shape/text_color.exp.json b/testdata/d2exporter/TestExport/shape/text_color.exp.json index db7273d5a..dc35c0b97 100644 --- a/testdata/d2exporter/TestExport/shape/text_color.exp.json +++ b/testdata/d2exporter/TestExport/shape/text_color.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/testdata/d2exporter/TestExport/theme/connection_with_bold.exp.json b/testdata/d2exporter/TestExport/theme/connection_with_bold.exp.json index cf2e7cf34..c0f461b9a 100644 --- a/testdata/d2exporter/TestExport/theme/connection_with_bold.exp.json +++ b/testdata/d2exporter/TestExport/theme/connection_with_bold.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -61,6 +62,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/testdata/d2exporter/TestExport/theme/connection_with_italic.exp.json b/testdata/d2exporter/TestExport/theme/connection_with_italic.exp.json index b3d780bb9..629847c8f 100644 --- a/testdata/d2exporter/TestExport/theme/connection_with_italic.exp.json +++ b/testdata/d2exporter/TestExport/theme/connection_with_italic.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -61,6 +62,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/testdata/d2exporter/TestExport/theme/connection_without_italic.exp.json b/testdata/d2exporter/TestExport/theme/connection_without_italic.exp.json index b1d30b075..dd3636dc0 100644 --- a/testdata/d2exporter/TestExport/theme/connection_without_italic.exp.json +++ b/testdata/d2exporter/TestExport/theme/connection_without_italic.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -61,6 +62,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/testdata/d2exporter/TestExport/theme/shape_with_italic.exp.json b/testdata/d2exporter/TestExport/theme/shape_with_italic.exp.json index 73a0eab3c..7672ab131 100644 --- a/testdata/d2exporter/TestExport/theme/shape_with_italic.exp.json +++ b/testdata/d2exporter/TestExport/theme/shape_with_italic.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/testdata/d2exporter/TestExport/theme/shape_without_bold.exp.json b/testdata/d2exporter/TestExport/theme/shape_without_bold.exp.json index e136a4d38..c8b3c3d9f 100644 --- a/testdata/d2exporter/TestExport/theme/shape_without_bold.exp.json +++ b/testdata/d2exporter/TestExport/theme/shape_without_bold.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null,