diff --git a/d2themes/d2themescatalog/default.go b/d2themes/d2themescatalog/default.go index bc658b83c..6fd3fb878 100644 --- a/d2themes/d2themescatalog/default.go +++ b/d2themes/d2themescatalog/default.go @@ -9,17 +9,17 @@ var NeutralDefault = d2themes.Theme{ Neutrals: d2themes.CoolNeutral, B1: "#0D32B2", - B2: "#234CDA", - B3: "#6B8AFB", - B4: "#A6B8F8", - B5: "#D2DBFD", - B6: "#E7EAFF", + B2: "#0D32B2", + B3: "#E3E9FD", + B4: "#E3E9FD", + B5: "#EDF0FD", + B6: "#F7F8FE", - AA2: "#234CDA", - AA4: "#A6B8F8", - AA5: "#D2DBFD", + AA2: "#4A6FF3", + AA4: "#EDF0FD", + AA5: "#F7F8FE", - AB4: "#A6B8F8", - AB5: "#D2DBFD", + AB4: "#EDF0FD", + AB5: "#F7F8FE", }, } diff --git a/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json b/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json index 2b5e5799f..53c443478 100644 --- a/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json +++ b/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg b/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg index a7209bda3..d38113b44 100644 --- a/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg +++ b/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="486" height="552" viewBox="-100 -100 486 552">abc abc abc abc ab ab ab ab acbd acbd acbd acbd ab hello +ab hello ab hello +ab hello rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud cba * cba * cba * cba * ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* abcdefghijklmno abcdefghijklmno abcdefghijklmno abcdefghijklmno aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos1/elk/board.exp.json b/e2etests/testdata/stable/chaos1/elk/board.exp.json index 8372dc96c..d7fcac07d 100644 --- a/e2etests/testdata/stable/chaos1/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos1/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg index 3579dbca5..62b3bffda 100644 --- a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="630" height="869" viewBox="-88 -88 630 869">aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos2/dagre/board.exp.json b/e2etests/testdata/stable/chaos2/dagre/board.exp.json index 508c2ef0a..c928b6a24 100644 --- a/e2etests/testdata/stable/chaos2/dagre/board.exp.json +++ b/e2etests/testdata/stable/chaos2/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg index 4b58359f7..06d891441 100644 --- a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg @@ -774,8 +774,8 @@ width="1317" height="1854" viewBox="-100 -100 1317 1854">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/chaos2/elk/board.exp.json b/e2etests/testdata/stable/chaos2/elk/board.exp.json index 31a4ce86a..1aa503f04 100644 --- a/e2etests/testdata/stable/chaos2/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos2/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg index d44e03424..174d4500f 100644 --- a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg @@ -774,8 +774,8 @@ width="1092" height="1907" viewBox="-88 -88 1092 1907">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json index 00b6ab18a..0ba6c70e2 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg index 712788c3f..89f73af80 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="724" height="626" viewBox="-100 -100 724 626">abcd abcd abcd abcd abc abc abc abc acfbdhg acfbdhg acfbdhg acfbdhg agdfbhec agdfbhec agdfbhec agdfbhec abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot bacde21345abcde bacde21345abcde bacde21345abcde bacde21345abcde alphabeta gamma +alphabeta gamma alphabeta gamma +alphabeta gamma size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/font_sizes/elk/board.exp.json b/e2etests/testdata/stable/font_sizes/elk/board.exp.json index fbbabd15f..2d5446e61 100644 --- a/e2etests/testdata/stable/font_sizes/elk/board.exp.json +++ b/e2etests/testdata/stable/font_sizes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg index c9d42780f..02055f08d 100644 --- a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1965" height="793" viewBox="-88 -88 1965 793">size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json index 297460a3b..62256201b 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json @@ -53,7 +53,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg index 8ed8fda49..91b32cb2e 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg @@ -1031,7 +1031,7 @@ title for the link, surrounded in quotes. For example:

Code

Unlike a pre-formatted code block, a code span indicates code within a normal paragraph. For example:

-
ab hellohellohellohelloaabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/investigate/elk/board.exp.json b/e2etests/testdata/stable/investigate/elk/board.exp.json index 70aece788..6e983b96d 100644 --- a/e2etests/testdata/stable/investigate/elk/board.exp.json +++ b/e2etests/testdata/stable/investigate/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -505,7 +505,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -836,7 +836,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -876,7 +876,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -916,7 +916,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -996,7 +996,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1036,7 +1036,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1076,7 +1076,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1116,7 +1116,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1156,7 +1156,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1196,7 +1196,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1236,7 +1236,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg index 59d90964e..6655cd820 100644 --- a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="860" height="4868" viewBox="-82 -88 860 4868">aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/large_arch/dagre/board.exp.json b/e2etests/testdata/stable/large_arch/dagre/board.exp.json index c81e7d197..f62e8f5a5 100644 --- a/e2etests/testdata/stable/large_arch/dagre/board.exp.json +++ b/e2etests/testdata/stable/large_arch/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -574,7 +574,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -614,7 +614,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -654,7 +654,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -694,7 +694,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -734,7 +734,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -774,7 +774,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -814,7 +814,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -894,7 +894,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -934,7 +934,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -974,7 +974,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1014,7 +1014,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1054,7 +1054,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1094,7 +1094,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1134,7 +1134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1174,7 +1174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1214,7 +1214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1254,7 +1254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1294,7 +1294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg index f3886ef15..13eab90b5 100644 --- a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3244" height="1780" viewBox="-100 -100 3244 1780">abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv mixed togethersugarsolution we get +mixed togethersugarsolution we get mixed togethersugarsolution we get +mixed togethersugarsolution we get

Markdown: Syntax

-
ab

Markdown: Syntax

-
ab markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

code

-
ab

code

-
ab thisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesabcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu Foo Baz12hello Foo Baz12hello Foo Baz12hello Foo Baz12hello acdefgbh acdefgbh acdefgbh acdefgbh topabcbottomstartend topabcbottomstartend topabcbottomstartend topabcbottomstartend xyz hello +xyz hello xyz hello +xyz hello an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json index 55a1eec78..2341f4127 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -527,7 +527,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -566,7 +566,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -605,7 +605,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -644,7 +644,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -683,7 +683,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg index a46f8c90c..0e9876acc 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2692" height="1396" viewBox="-76 -26 2692 1396">an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json index a32ed6952..9f037376a 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg index 79f25a284..b6bd742f3 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json index a32ed6952..9f037376a 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg index 79f25a284..b6bd742f3 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json index d6847cc42..bf7d446c6 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg index 9688e4378..225993ad1 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json index d6847cc42..bf7d446c6 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg index 9688e4378..225993ad1 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json index 904780096..d423c7d1d 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -213,7 +213,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -252,7 +252,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg index 7e9cb62f6..e341c6b43 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="850" height="1162" viewBox="-263 -26 850 1162">ba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnoteherescoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json index a51050906..39b144a5b 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -413,7 +413,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -532,7 +532,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1078,7 +1078,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1117,7 +1117,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1156,7 +1156,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1195,7 +1195,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1234,7 +1234,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1273,7 +1273,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1312,7 +1312,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1351,7 +1351,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1390,7 +1390,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg index b50e4e1a0..f2f4d06d7 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2447" height="2536" viewBox="-88 -88 2447 2536">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json index a98679802..72a7057a3 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg index a415d747a..7908c57da 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json index a98679802..72a7057a3 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg index a415d747a..7908c57da 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json index 24a642b5f..1ceb33052 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg index ea3486ab6..14dc4497b 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json index 24a642b5f..1ceb33052 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg index ea3486ab6..14dc4497b 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json index 50fdefffc..d63c990f4 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg index c61f0cb1b..f91003569 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json index 50fdefffc..d63c990f4 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg index c61f0cb1b..f91003569 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json index cbdb7a97f..e6fd7e966 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4161,7 +4161,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4200,7 +4200,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4239,7 +4239,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4278,7 +4278,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4317,7 +4317,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4356,7 +4356,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4395,7 +4395,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4434,7 +4434,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4473,7 +4473,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4512,7 +4512,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4551,7 +4551,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4590,7 +4590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4629,7 +4629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4668,7 +4668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4707,7 +4707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4746,7 +4746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4785,7 +4785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4824,7 +4824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg index eb0b93c75..5b7b87c12 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3402" height="4269" viewBox="-100 -100 3402 4269">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json index ed74bde39..7962381f1 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4080,7 +4080,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4119,7 +4119,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4158,7 +4158,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4197,7 +4197,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4236,7 +4236,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4275,7 +4275,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4314,7 +4314,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4353,7 +4353,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4392,7 +4392,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4431,7 +4431,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4470,7 +4470,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4509,7 +4509,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4548,7 +4548,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4587,7 +4587,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4626,7 +4626,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4665,7 +4665,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4704,7 +4704,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4743,7 +4743,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg index 98eabe978..515cfa72d 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="3324" height="4389" viewBox="-88 -88 3324 4389">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/square_3d/dagre/board.exp.json b/e2etests/testdata/stable/square_3d/dagre/board.exp.json index 961981fc6..8a037500b 100644 --- a/e2etests/testdata/stable/square_3d/dagre/board.exp.json +++ b/e2etests/testdata/stable/square_3d/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": true, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": true, diff --git a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg index 536b963fa..834d15ac7 100644 --- a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg @@ -20,9 +20,9 @@ width="371" height="580" viewBox="-100 -100 371 580"> -rectangle +rectangle -square -rectangle +rectangle -square acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc AKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDcontainerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json index f55ea2ba1..35b0e5dd0 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json +++ b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg index a80b6ae79..df3ac9c7a 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="536" height="663" viewBox="-88 -88 536 663">containerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json index 3dddb42bd..f3951de5d 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg index 6a50fec38..bf4b4f2b7 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="664" height="716" viewBox="-100 -100 664 716">ninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneighteightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json index 54a4ee87e..d012e76be 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg index 1b1f29ab4..c417a43f7 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="789" height="2014" viewBox="-39 -88 789 2014">eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json index 4cf3eda9b..bf9dc2e70 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -563,7 +563,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -602,7 +602,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -641,7 +641,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg index 96cc12cb0..45f3f9430 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="921" height="1242" viewBox="-147 -26 921 1242">bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel