diff --git a/d2themes/d2themescatalog/default.go b/d2themes/d2themescatalog/default.go index bd240a16d..6fd3fb878 100644 --- a/d2themes/d2themescatalog/default.go +++ b/d2themes/d2themescatalog/default.go @@ -9,17 +9,17 @@ var NeutralDefault = d2themes.Theme{ Neutrals: d2themes.CoolNeutral, B1: "#0D32B2", - B2: "#2952E4", - B3: "#B0C0FB", - B4: "#D2DBFD", - B5: "#E7EAFF", - B6: "#F4F6FD", + B2: "#0D32B2", + B3: "#E3E9FD", + B4: "#E3E9FD", + B5: "#EDF0FD", + B6: "#F7F8FE", - AA2: "#2952E4", - AA4: "#D2DBFD", - AA5: "#E7EAFF", + AA2: "#4A6FF3", + AA4: "#EDF0FD", + AA5: "#F7F8FE", - AB4: "#D2DBFD", - AB5: "#E7EAFF", + AB4: "#EDF0FD", + AB5: "#F7F8FE", }, } diff --git a/e2etests/stable_test.go b/e2etests/stable_test.go index 22d6b86ec..230528899 100644 --- a/e2etests/stable_test.go +++ b/e2etests/stable_test.go @@ -1451,7 +1451,8 @@ c: "just an actor" d2exporter.export -> CLI: resulting SVG } `, - }, { + }, + { name: "sequence_diagram_actor_distance", script: `shape: sequence_diagram a: "an actor with a really long label that will break everything" diff --git a/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json b/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json index 68718fd35..53c443478 100644 --- a/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json +++ b/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg b/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg index bb1c3505b..d38113b44 100644 --- a/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg +++ b/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="486" height="552" viewBox="-100 -100 486 552">abc abc abc abc ab ab ab ab acbd acbd acbd acbd ab hello +ab hello ab hello +ab hello rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud cba * cba * cba * cba * ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* abcdefghijklmno abcdefghijklmno abcdefghijklmno abcdefghijklmno aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos1/elk/board.exp.json b/e2etests/testdata/stable/chaos1/elk/board.exp.json index 592be572b..d7fcac07d 100644 --- a/e2etests/testdata/stable/chaos1/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos1/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg index 8434d13b9..62b3bffda 100644 --- a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="630" height="869" viewBox="-88 -88 630 869">aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos2/dagre/board.exp.json b/e2etests/testdata/stable/chaos2/dagre/board.exp.json index c48e2c6ea..c928b6a24 100644 --- a/e2etests/testdata/stable/chaos2/dagre/board.exp.json +++ b/e2etests/testdata/stable/chaos2/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg index e557f8e3d..06d891441 100644 --- a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg @@ -774,8 +774,8 @@ width="1317" height="1854" viewBox="-100 -100 1317 1854">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/chaos2/elk/board.exp.json b/e2etests/testdata/stable/chaos2/elk/board.exp.json index b4ecab40f..1aa503f04 100644 --- a/e2etests/testdata/stable/chaos2/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos2/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg index 5025c844b..174d4500f 100644 --- a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg @@ -774,8 +774,8 @@ width="1092" height="1907" viewBox="-88 -88 1092 1907">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json index 1f3b3d8ea..0ba6c70e2 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg index e1f282145..89f73af80 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="724" height="626" viewBox="-100 -100 724 626">abcd abcd abcd abcd abc abc abc abc acfbdhg acfbdhg acfbdhg acfbdhg agdfbhec agdfbhec agdfbhec agdfbhec abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot bacde21345abcde bacde21345abcde bacde21345abcde bacde21345abcde alphabeta gamma +alphabeta gamma alphabeta gamma +alphabeta gamma size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/font_sizes/elk/board.exp.json b/e2etests/testdata/stable/font_sizes/elk/board.exp.json index 498da91ca..2d5446e61 100644 --- a/e2etests/testdata/stable/font_sizes/elk/board.exp.json +++ b/e2etests/testdata/stable/font_sizes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg index fd230f08e..02055f08d 100644 --- a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1965" height="793" viewBox="-88 -88 1965 793">size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json index 904218a42..62256201b 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json @@ -53,7 +53,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg index 153ac2cc0..91b32cb2e 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg @@ -1031,7 +1031,7 @@ title for the link, surrounded in quotes. For example:

Code

Unlike a pre-formatted code block, a code span indicates code within a normal paragraph. For example:

-
ab hellohellohellohelloaabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/investigate/elk/board.exp.json b/e2etests/testdata/stable/investigate/elk/board.exp.json index d7887cee8..6e983b96d 100644 --- a/e2etests/testdata/stable/investigate/elk/board.exp.json +++ b/e2etests/testdata/stable/investigate/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -505,7 +505,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -836,7 +836,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -876,7 +876,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -916,7 +916,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -996,7 +996,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1036,7 +1036,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1076,7 +1076,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1116,7 +1116,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1156,7 +1156,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1196,7 +1196,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1236,7 +1236,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg index 07d7c9369..6655cd820 100644 --- a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="860" height="4868" viewBox="-82 -88 860 4868">aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/large_arch/dagre/board.exp.json b/e2etests/testdata/stable/large_arch/dagre/board.exp.json index 86ef27a13..f62e8f5a5 100644 --- a/e2etests/testdata/stable/large_arch/dagre/board.exp.json +++ b/e2etests/testdata/stable/large_arch/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -574,7 +574,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -614,7 +614,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -654,7 +654,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -694,7 +694,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -734,7 +734,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -774,7 +774,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -814,7 +814,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -894,7 +894,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -934,7 +934,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -974,7 +974,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1014,7 +1014,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1054,7 +1054,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1094,7 +1094,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1134,7 +1134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1174,7 +1174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1214,7 +1214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1254,7 +1254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1294,7 +1294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg index 24bbbf19c..13eab90b5 100644 --- a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3244" height="1780" viewBox="-100 -100 3244 1780">abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv mixed togethersugarsolution we get +mixed togethersugarsolution we get mixed togethersugarsolution we get +mixed togethersugarsolution we get

Markdown: Syntax

-
ab

Markdown: Syntax

-
ab markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

code

-
ab

code

-
ab thisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesabcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu Foo Baz12hello Foo Baz12hello Foo Baz12hello Foo Baz12hello acdefgbh acdefgbh acdefgbh acdefgbh topabcbottomstartend topabcbottomstartend topabcbottomstartend topabcbottomstartend xyz hello +xyz hello xyz hello +xyz hello an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json index c110ffb9f..2341f4127 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -527,7 +527,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -566,7 +566,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -605,7 +605,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -644,7 +644,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -683,7 +683,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg index b23e2a894..0e9876acc 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2692" height="1396" viewBox="-76 -26 2692 1396">an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json index 5ba5188b6..9f037376a 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg index d62bed291..b6bd742f3 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json index 5ba5188b6..9f037376a 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg index d62bed291..b6bd742f3 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json index 5f4deb35f..3fd82835d 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg index e70cbbc29..ec8e7b216 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json index 5f4deb35f..3fd82835d 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg index e70cbbc29..ec8e7b216 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json index ab449d330..d423c7d1d 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -213,7 +213,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -252,7 +252,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg index 1df8c0fea..e341c6b43 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="850" height="1162" viewBox="-263 -26 850 1162">ba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnoteherescoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json index 489789116..b303818b1 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -413,7 +413,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -532,7 +532,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1078,7 +1078,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1117,7 +1117,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1156,7 +1156,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1195,7 +1195,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1234,7 +1234,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1273,7 +1273,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1312,7 +1312,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1351,7 +1351,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1390,7 +1390,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg index c229cf631..9e6ceb66d 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2447" height="2536" viewBox="-88 -88 2447 2536">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json index 95bd3ecee..4c8d9cd09 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -211,7 +211,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg index 516abbea1..f27e77a00 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json index 95bd3ecee..4c8d9cd09 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -211,7 +211,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg index 516abbea1..f27e77a00 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json index 61a83ea65..1ceb33052 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg index 514a06e0b..14dc4497b 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json index 61a83ea65..1ceb33052 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg index 514a06e0b..14dc4497b 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json index 00c75c1a9..af401f123 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -330,7 +330,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg index 9a2b4dca8..a38b8914f 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json index 00c75c1a9..af401f123 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -330,7 +330,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg index 9a2b4dca8..a38b8914f 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json index a87c5874a..fb7550f69 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -810,7 +810,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1479,7 +1479,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1950,7 +1950,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2028,7 +2028,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2145,7 +2145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2301,7 +2301,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4161,7 +4161,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4200,7 +4200,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4239,7 +4239,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4278,7 +4278,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4317,7 +4317,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4356,7 +4356,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4395,7 +4395,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4434,7 +4434,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4473,7 +4473,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4512,7 +4512,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4551,7 +4551,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4590,7 +4590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4629,7 +4629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4668,7 +4668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4707,7 +4707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4746,7 +4746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4785,7 +4785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4824,7 +4824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg index fab9122c5..cc85ee061 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3402" height="4269" viewBox="-100 -100 3402 4269">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json index 93a2f4d96..3ed298e02 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -810,7 +810,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1479,7 +1479,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1950,7 +1950,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2028,7 +2028,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2145,7 +2145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2301,7 +2301,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4080,7 +4080,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4119,7 +4119,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4158,7 +4158,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4197,7 +4197,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4236,7 +4236,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4275,7 +4275,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4314,7 +4314,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4353,7 +4353,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4392,7 +4392,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4431,7 +4431,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4470,7 +4470,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4509,7 +4509,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4548,7 +4548,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4587,7 +4587,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4626,7 +4626,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4665,7 +4665,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4704,7 +4704,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4743,7 +4743,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg index b5128161a..ac2e03f6c 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="3324" height="4389" viewBox="-88 -88 3324 4389">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/square_3d/dagre/board.exp.json b/e2etests/testdata/stable/square_3d/dagre/board.exp.json index ae0b398cd..8a037500b 100644 --- a/e2etests/testdata/stable/square_3d/dagre/board.exp.json +++ b/e2etests/testdata/stable/square_3d/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": true, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": true, diff --git a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg index 8070f9471..834d15ac7 100644 --- a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg @@ -20,9 +20,9 @@ width="371" height="580" viewBox="-100 -100 371 580"> -rectangle +rectangle -square -rectangle +rectangle -square acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc AKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDcontainerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json index aec76c448..35b0e5dd0 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json +++ b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg index e2c86e47a..df3ac9c7a 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="536" height="663" viewBox="-88 -88 536 663">containerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json index c36a465ab..f3951de5d 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg index 5dda9ae06..bf4b4f2b7 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="664" height="716" viewBox="-100 -100 664 716">ninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneighteightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json index dae1aff5b..d012e76be 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg index f42b3ddce..c417a43f7 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="789" height="2014" viewBox="-39 -88 789 2014">eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json index 8e5611289..bf9dc2e70 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -563,7 +563,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -602,7 +602,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -641,7 +641,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg index e9cb1975f..45f3f9430 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="921" height="1242" viewBox="-147 -26 921 1242">bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel