Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdownLorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.
markdownLorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdownLorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.
markdownLorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdownLorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.
markdownLorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdownLorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.
ab ab thisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesabcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu Foo Baz12hello Foo Baz12hello Foo Baz12hello Foo Baz12hello acdefgbh acdefgbh acdefgbh acdefgbh topabcbottomstartend topabcbottomstartend topabcbottomstartend topabcbottomstartend xyz hello
+xyz hello
xyz hello
+xyz hello
an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long
+an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long
diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json
index 2341f4127..55a1eec78 100644
--- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json
+++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json
@@ -14,7 +14,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -54,7 +54,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -94,7 +94,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -134,7 +134,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -174,7 +174,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -214,7 +214,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -488,7 +488,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -527,7 +527,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -566,7 +566,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -605,7 +605,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -644,7 +644,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -683,7 +683,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg
index 0e9876acc..a46f8c90c 100644
--- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg
+++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg
@@ -18,7 +18,7 @@ width="2692" height="1396" viewBox="-76 -26 2692 1396">an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long
+an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long
diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json
index 9f037376a..a32ed6952 100644
--- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json
+++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json
@@ -14,7 +14,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -54,7 +54,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -94,7 +94,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0A0F25",
"shadow": false,
"3d": false,
@@ -145,7 +145,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -185,7 +185,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0A0F25",
"shadow": false,
"3d": false,
@@ -225,7 +225,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -265,7 +265,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -305,7 +305,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -345,7 +345,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -385,7 +385,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -436,7 +436,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -476,7 +476,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -516,7 +516,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -556,7 +556,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -596,7 +596,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -636,7 +636,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -676,7 +676,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -716,7 +716,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -756,7 +756,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -796,7 +796,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0A0F25",
"shadow": false,
"3d": false,
@@ -1590,7 +1590,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1629,7 +1629,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1668,7 +1668,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1707,7 +1707,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1746,7 +1746,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1785,7 +1785,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1824,7 +1824,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1863,7 +1863,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1902,7 +1902,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1941,7 +1941,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1980,7 +1980,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -2019,7 +2019,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -2058,7 +2058,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -2097,7 +2097,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -2136,7 +2136,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -2175,7 +2175,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -2214,7 +2214,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -2253,7 +2253,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -2292,7 +2292,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -2331,7 +2331,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg
index b6bd742f3..79f25a284 100644
--- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg
+++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg
@@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+
+a labelblabelsa class+
public() bool
void-
private() int
-voidcloudyyyya := 5
+voidcloudyyyya := 5
b := a + 7
-fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid
+fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid
int
name
varchar
- result := callThisFunction(obj, 5) midthis sideother side
+ result := callThisFunction(obj, 5) midthis sideother side
diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json
index 9f037376a..a32ed6952 100644
--- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json
+++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json
@@ -14,7 +14,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -54,7 +54,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -94,7 +94,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0A0F25",
"shadow": false,
"3d": false,
@@ -145,7 +145,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -185,7 +185,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0A0F25",
"shadow": false,
"3d": false,
@@ -225,7 +225,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -265,7 +265,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -305,7 +305,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -345,7 +345,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -385,7 +385,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -436,7 +436,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -476,7 +476,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -516,7 +516,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -556,7 +556,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -596,7 +596,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -636,7 +636,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -676,7 +676,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -716,7 +716,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -756,7 +756,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -796,7 +796,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0A0F25",
"shadow": false,
"3d": false,
@@ -1590,7 +1590,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1629,7 +1629,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1668,7 +1668,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1707,7 +1707,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1746,7 +1746,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1785,7 +1785,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1824,7 +1824,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1863,7 +1863,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1902,7 +1902,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1941,7 +1941,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1980,7 +1980,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -2019,7 +2019,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -2058,7 +2058,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -2097,7 +2097,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -2136,7 +2136,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -2175,7 +2175,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -2214,7 +2214,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -2253,7 +2253,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -2292,7 +2292,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -2331,7 +2331,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg
index b6bd742f3..79f25a284 100644
--- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg
+++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg
@@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+
+a labelblabelsa class+
public() bool
void-
private() int
-voidcloudyyyya := 5
+voidcloudyyyya := 5
b := a + 7
-fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid
+fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid
int
name
varchar
- result := callThisFunction(obj, 5) midthis sideother side
+ result := callThisFunction(obj, 5) midthis sideother side
diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json
index 00aca25ac..d6847cc42 100644
--- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json
+++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json
@@ -14,7 +14,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -54,7 +54,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -94,7 +94,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -134,7 +134,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -449,7 +449,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -488,7 +488,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -527,7 +527,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -956,7 +956,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -995,7 +995,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1034,7 +1034,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1073,7 +1073,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg
index baad6e566..9688e4378 100644
--- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg
+++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg
@@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note
+abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note
diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json
index 00aca25ac..d6847cc42 100644
--- a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json
+++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json
@@ -14,7 +14,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -54,7 +54,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -94,7 +94,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -134,7 +134,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -449,7 +449,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -488,7 +488,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -527,7 +527,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -956,7 +956,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -995,7 +995,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1034,7 +1034,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1073,7 +1073,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg
index baad6e566..9688e4378 100644
--- a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg
+++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg
@@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note
+abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note
diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json
index d423c7d1d..904780096 100644
--- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json
+++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json
@@ -14,7 +14,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -94,7 +94,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -213,7 +213,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -252,7 +252,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg
index e341c6b43..7e9cb62f6 100644
--- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg
+++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg
@@ -18,7 +18,7 @@ width="850" height="1162" viewBox="-263 -26 850 1162">ba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnoteherescoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier
+abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier
abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier
+abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier
How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place
+How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place
diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json
index 39b144a5b..a51050906 100644
--- a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json
+++ b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json
@@ -54,7 +54,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -94,7 +94,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -134,7 +134,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -174,7 +174,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -214,7 +214,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -254,7 +254,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -294,7 +294,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -413,7 +413,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -452,7 +452,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -492,7 +492,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -532,7 +532,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1078,7 +1078,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1117,7 +1117,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1156,7 +1156,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1195,7 +1195,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1234,7 +1234,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1273,7 +1273,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1312,7 +1312,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1351,7 +1351,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1390,7 +1390,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg
index f2f4d06d7..b50e4e1a0 100644
--- a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg
+++ b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg
@@ -18,7 +18,7 @@ width="2447" height="2536" viewBox="-88 -88 2447 2536">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place
+How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place
diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json
index 76f3e5d4d..a98679802 100644
--- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json
+++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json
@@ -14,7 +14,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -54,7 +54,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -94,7 +94,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -133,7 +133,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -172,7 +172,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -211,7 +211,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -250,7 +250,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -594,7 +594,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -633,7 +633,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg
index 72424b802..a415d747a 100644
--- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg
+++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg
@@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor
+ab a self edge herebetween actorsto descendantto deeper descendantto parentactor
diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json
index 76f3e5d4d..a98679802 100644
--- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json
+++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json
@@ -14,7 +14,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -54,7 +54,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -94,7 +94,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -133,7 +133,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -172,7 +172,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -211,7 +211,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -250,7 +250,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -594,7 +594,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -633,7 +633,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg
index 72424b802..a415d747a 100644
--- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg
+++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg
@@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor
+ab a self edge herebetween actorsto descendantto deeper descendantto parentactor
diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json
index 1ceb33052..24a642b5f 100644
--- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json
+++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json
@@ -14,7 +14,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "red",
"shadow": false,
"3d": false,
@@ -54,7 +54,7 @@
"strokeDash": 0,
"strokeWidth": 5,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -94,7 +94,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -134,7 +134,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -174,7 +174,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -331,7 +331,7 @@
"opacity": 1,
"strokeDash": 4,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -370,7 +370,7 @@
"opacity": 1,
"strokeDash": 4,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -604,7 +604,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -643,7 +643,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -682,7 +682,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -721,7 +721,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -760,7 +760,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg
index 14dc4497b..ea3486ab6 100644
--- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg
+++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg
@@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response
+AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response
diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json
index 1ceb33052..24a642b5f 100644
--- a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json
+++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json
@@ -14,7 +14,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "red",
"shadow": false,
"3d": false,
@@ -54,7 +54,7 @@
"strokeDash": 0,
"strokeWidth": 5,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -94,7 +94,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -134,7 +134,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -174,7 +174,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -331,7 +331,7 @@
"opacity": 1,
"strokeDash": 4,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -370,7 +370,7 @@
"opacity": 1,
"strokeDash": 4,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -604,7 +604,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -643,7 +643,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -682,7 +682,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -721,7 +721,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -760,7 +760,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg
index 14dc4497b..ea3486ab6 100644
--- a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg
+++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg
@@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response
+AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response
diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json
index 85ae8a91f..50fdefffc 100644
--- a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json
+++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json
@@ -14,7 +14,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -54,7 +54,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -93,7 +93,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -133,7 +133,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -172,7 +172,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -212,7 +212,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -251,7 +251,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -291,7 +291,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -330,7 +330,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -369,7 +369,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -409,7 +409,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -448,7 +448,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -488,7 +488,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -527,7 +527,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -566,7 +566,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -605,7 +605,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -644,7 +644,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1190,7 +1190,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1229,7 +1229,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1268,7 +1268,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1307,7 +1307,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1346,7 +1346,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1385,7 +1385,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg
index cb113b131..c61f0cb1b 100644
--- a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg
+++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg
@@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)
+scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)
diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json
index 85ae8a91f..50fdefffc 100644
--- a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json
+++ b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json
@@ -14,7 +14,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -54,7 +54,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -93,7 +93,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -133,7 +133,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -172,7 +172,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -212,7 +212,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -251,7 +251,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -291,7 +291,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -330,7 +330,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -369,7 +369,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -409,7 +409,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -448,7 +448,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -488,7 +488,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -527,7 +527,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -566,7 +566,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -605,7 +605,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -644,7 +644,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1190,7 +1190,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1229,7 +1229,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1268,7 +1268,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1307,7 +1307,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1346,7 +1346,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -1385,7 +1385,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg
index cb113b131..c61f0cb1b 100644
--- a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg
+++ b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg
@@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)
+scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)
diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json
index b054cf783..cbdb7a97f 100644
--- a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json
+++ b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json
@@ -14,7 +14,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -94,7 +94,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#E3E9FD",
+ "fill": "#A6B8F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -254,7 +254,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -294,7 +294,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -334,7 +334,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -374,7 +374,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -414,7 +414,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -454,7 +454,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -494,7 +494,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -534,7 +534,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -573,7 +573,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -613,7 +613,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -652,7 +652,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -692,7 +692,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -731,7 +731,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -771,7 +771,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -810,7 +810,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -849,7 +849,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -889,7 +889,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -928,7 +928,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -968,7 +968,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1007,7 +1007,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1046,7 +1046,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1085,7 +1085,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1124,7 +1124,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1163,7 +1163,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1203,7 +1203,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1242,7 +1242,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1282,7 +1282,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1321,7 +1321,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1361,7 +1361,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1400,7 +1400,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1440,7 +1440,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1479,7 +1479,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1518,7 +1518,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1558,7 +1558,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1597,7 +1597,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1637,7 +1637,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1676,7 +1676,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1715,7 +1715,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1754,7 +1754,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1793,7 +1793,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1832,7 +1832,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1872,7 +1872,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1911,7 +1911,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1950,7 +1950,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1989,7 +1989,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -2028,7 +2028,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -2106,7 +2106,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -2145,7 +2145,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -2262,7 +2262,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -2301,7 +2301,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -2457,7 +2457,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -2496,7 +2496,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -4161,7 +4161,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4200,7 +4200,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4239,7 +4239,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4278,7 +4278,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4317,7 +4317,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4356,7 +4356,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4395,7 +4395,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4434,7 +4434,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4473,7 +4473,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4512,7 +4512,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4551,7 +4551,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4590,7 +4590,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4629,7 +4629,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4668,7 +4668,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4707,7 +4707,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4746,7 +4746,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4785,7 +4785,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4824,7 +4824,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg
index 468339af5..eb0b93c75 100644
--- a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg
+++ b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg
@@ -18,7 +18,7 @@ width="3402" height="4269" viewBox="-100 -100 3402 4269">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)
+a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)
diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json
index 030b0be63..ed74bde39 100644
--- a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json
+++ b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json
@@ -14,7 +14,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -94,7 +94,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#E3E9FD",
+ "fill": "#A6B8F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -254,7 +254,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -294,7 +294,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -334,7 +334,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -374,7 +374,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -414,7 +414,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -454,7 +454,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -494,7 +494,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -534,7 +534,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -573,7 +573,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -613,7 +613,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -652,7 +652,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -692,7 +692,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -731,7 +731,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -771,7 +771,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -810,7 +810,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -849,7 +849,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -889,7 +889,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -928,7 +928,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -968,7 +968,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1007,7 +1007,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1046,7 +1046,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1085,7 +1085,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1124,7 +1124,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1163,7 +1163,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1203,7 +1203,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1242,7 +1242,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1282,7 +1282,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1321,7 +1321,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1361,7 +1361,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1400,7 +1400,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1440,7 +1440,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1479,7 +1479,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1518,7 +1518,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1558,7 +1558,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1597,7 +1597,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1637,7 +1637,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1676,7 +1676,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1715,7 +1715,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1754,7 +1754,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1793,7 +1793,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1832,7 +1832,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1872,7 +1872,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1911,7 +1911,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1950,7 +1950,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -1989,7 +1989,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -2028,7 +2028,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -2106,7 +2106,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -2145,7 +2145,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -2262,7 +2262,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -2301,7 +2301,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#EEF1F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -2457,7 +2457,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -2496,7 +2496,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#FFFFFF",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -4080,7 +4080,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4119,7 +4119,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4158,7 +4158,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4197,7 +4197,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4236,7 +4236,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4275,7 +4275,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4314,7 +4314,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4353,7 +4353,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4392,7 +4392,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4431,7 +4431,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4470,7 +4470,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4509,7 +4509,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4548,7 +4548,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4587,7 +4587,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4626,7 +4626,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4665,7 +4665,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4704,7 +4704,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -4743,7 +4743,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg
index c76a1e7eb..98eabe978 100644
--- a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg
+++ b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg
@@ -18,7 +18,7 @@ width="3324" height="4389" viewBox="-88 -88 3324 4389">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)
+a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)
diff --git a/e2etests/testdata/stable/square_3d/dagre/board.exp.json b/e2etests/testdata/stable/square_3d/dagre/board.exp.json
index 8a037500b..961981fc6 100644
--- a/e2etests/testdata/stable/square_3d/dagre/board.exp.json
+++ b/e2etests/testdata/stable/square_3d/dagre/board.exp.json
@@ -14,7 +14,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": true,
@@ -54,7 +54,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": true,
diff --git a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg
index 834d15ac7..536b963fa 100644
--- a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg
+++ b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg
@@ -20,9 +20,9 @@ width="371" height="580" viewBox="-100 -100 371 580">
-rectangle
+rectangle
-square
-rectangle
+rectangle
-square acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc AKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDcontainerfirstsecond 1->2c->2
+containerfirstsecond 1->2c->2
diff --git a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json
index 35b0e5dd0..f55ea2ba1 100644
--- a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json
+++ b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json
@@ -14,7 +14,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#E3E9FD",
+ "fill": "#A6B8F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -54,7 +54,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -94,7 +94,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
diff --git a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg
index df3ac9c7a..a80b6ae79 100644
--- a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg
+++ b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg
@@ -18,7 +18,7 @@ width="536" height="663" viewBox="-88 -88 536 663">containerfirstsecond 1->2c->2
+containerfirstsecond 1->2c->2
diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json
index f3951de5d..3dddb42bd 100644
--- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json
+++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json
@@ -14,7 +14,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#E3E9FD",
+ "fill": "#A6B8F8",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -54,7 +54,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -94,7 +94,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg
index bf4b4f2b7..6a50fec38 100644
--- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg
+++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg
@@ -18,7 +18,7 @@ width="664" height="716" viewBox="-100 -100 664 716">ninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneighteightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one
+eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one
diff --git a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json
index d012e76be..54a4ee87e 100644
--- a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json
+++ b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json
@@ -14,7 +14,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -54,7 +54,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -94,7 +94,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -134,7 +134,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -174,7 +174,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#F7F8FE",
+ "fill": "#E7EAFF",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
diff --git a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg
index c417a43f7..1b1f29ab4 100644
--- a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg
+++ b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg
@@ -18,7 +18,7 @@ width="789" height="2014" viewBox="-39 -88 789 2014">eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one
+eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one
diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json
index bf9dc2e70..4cf3eda9b 100644
--- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json
+++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json
@@ -14,7 +14,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -54,7 +54,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -94,7 +94,7 @@
"strokeDash": 0,
"strokeWidth": 2,
"borderRadius": 0,
- "fill": "#EDF0FD",
+ "fill": "#D2DBFD",
"stroke": "#0D32B2",
"shadow": false,
"3d": false,
@@ -563,7 +563,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -602,7 +602,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
@@ -641,7 +641,7 @@
"opacity": 1,
"strokeDash": 6,
"strokeWidth": 2,
- "stroke": "#0D32B2",
+ "stroke": "#234CDA",
"label": "",
"fontSize": 16,
"fontFamily": "DEFAULT",
diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg
index 45f3f9430..96cc12cb0 100644
--- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg
+++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg
@@ -18,7 +18,7 @@ width="921" height="1242" viewBox="-147 -26 921 1242">bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo ab Thereoncewasaverytalledgelabel
+ab Thereoncewasaverytalledgelabel
ab Thereoncewasaverytalledgelabel
+ab Thereoncewasaverytalledgelabel