From 1b996043591caee8ac115f60c01cb17ccfbd47ba Mon Sep 17 00:00:00 2001 From: Alexander Wang Date: Mon, 5 Dec 2022 13:53:09 -0800 Subject: [PATCH 1/8] fix nested sequence diagram shape --- d2exporter/export.go | 5 + d2graph/d2graph.go | 16 +- d2layouts/d2sequence/layout.go | 20 +- d2renderers/d2svg/d2svg.go | 2 +- .../dagre/board.exp.json | 120 +-- .../dagre/sketch.exp.svg | 14 +- .../elk/board.exp.json | 120 +-- .../elk/sketch.exp.svg | 14 +- .../dagre/board.exp.json | 392 ++++----- .../dagre/sketch.exp.svg | 26 +- .../elk/board.exp.json | 392 ++++----- .../elk/sketch.exp.svg | 26 +- .../dagre/board.exp.json | 140 +-- .../dagre/sketch.exp.svg | 14 +- .../elk/board.exp.json | 140 +-- .../elk/sketch.exp.svg | 14 +- .../dagre/board.exp.json | 32 +- .../dagre/sketch.exp.svg | 4 +- .../elk/board.exp.json | 32 +- .../elk/sketch.exp.svg | 4 +- .../dagre/board.exp.json | 108 +-- .../dagre/sketch.exp.svg | 4 +- .../elk/board.exp.json | 108 +-- .../elk/sketch.exp.svg | 4 +- .../dagre/board.exp.json | 212 ++--- .../dagre/sketch.exp.svg | 4 +- .../elk/board.exp.json | 212 ++--- .../elk/sketch.exp.svg | 4 +- .../dagre/board.exp.json | 72 +- .../dagre/sketch.exp.svg | 6 +- .../sequence_diagram_note/elk/board.exp.json | 72 +- .../sequence_diagram_note/elk/sketch.exp.svg | 6 +- .../dagre/board.exp.json | 226 ++--- .../dagre/sketch.exp.svg | 32 +- .../sequence_diagram_real/elk/board.exp.json | 226 ++--- .../sequence_diagram_real/elk/sketch.exp.svg | 32 +- .../dagre/board.exp.json | 132 +-- .../dagre/sketch.exp.svg | 16 +- .../elk/board.exp.json | 132 +-- .../elk/sketch.exp.svg | 16 +- .../dagre/board.exp.json | 140 +-- .../dagre/sketch.exp.svg | 20 +- .../elk/board.exp.json | 140 +-- .../elk/sketch.exp.svg | 20 +- .../dagre/board.exp.json | 220 ++--- .../dagre/sketch.exp.svg | 28 +- .../sequence_diagram_span/elk/board.exp.json | 220 ++--- .../sequence_diagram_span/elk/sketch.exp.svg | 28 +- .../sequence_diagrams/dagre/board.exp.json | 800 +++++++++--------- .../sequence_diagrams/dagre/sketch.exp.svg | 54 +- .../sequence_diagrams/elk/board.exp.json | 734 ++++++++-------- .../sequence_diagrams/elk/sketch.exp.svg | 54 +- .../dagre/board.exp.json | 84 +- .../dagre/sketch.exp.svg | 4 +- .../elk/board.exp.json | 84 +- .../elk/sketch.exp.svg | 4 +- 56 files changed, 2897 insertions(+), 2888 deletions(-) diff --git a/d2exporter/export.go b/d2exporter/export.go index c65542362..d39831a2e 100644 --- a/d2exporter/export.go +++ b/d2exporter/export.go @@ -3,6 +3,7 @@ package d2exporter import ( "context" "strconv" + "strings" "oss.terrastruct.com/d2/d2graph" "oss.terrastruct.com/d2/d2target" @@ -99,6 +100,10 @@ func toShape(obj *d2graph.Object, theme *d2themes.Theme) d2target.Shape { shape.Italic = text.IsItalic shape.FontSize = text.FontSize + if strings.EqualFold(obj.Attributes.Shape.Value, d2target.ShapeSequenceDiagram) { + shape.StrokeWidth = 0 + } + if obj.IsSequenceDiagramGroup() { shape.StrokeWidth = 0 shape.Blend = true diff --git a/d2graph/d2graph.go b/d2graph/d2graph.go index 8b5f7003e..3da658f59 100644 --- a/d2graph/d2graph.go +++ b/d2graph/d2graph.go @@ -305,18 +305,6 @@ func (s *Style) Apply(key, value string) error { type ContainerLevel int -func (l ContainerLevel) Fill() string { - // Darkest (least nested) to lightest (most nested) - if l == 1 { - return "#E3E9FD" - } else if l == 2 { - return "#EDF0FD" - } else if l == 3 { - return "#F7F8FE" - } - return "#FFFFFF" -} - func (l ContainerLevel) LabelSize() int { // Largest to smallest if l == 1 { @@ -341,6 +329,10 @@ func (obj *Object) GetFill(theme *d2themes.Theme) string { shape := obj.Attributes.Shape.Value + if strings.EqualFold(shape, d2target.ShapeSequenceDiagram) { + return theme.Colors.Neutrals.N7 + } + if shape == "" || strings.EqualFold(shape, d2target.ShapeSquare) || strings.EqualFold(shape, d2target.ShapeCircle) || strings.EqualFold(shape, d2target.ShapeOval) || strings.EqualFold(shape, d2target.ShapeRectangle) { if level == 1 { if !obj.IsContainer() { diff --git a/d2layouts/d2sequence/layout.go b/d2layouts/d2sequence/layout.go index 33e82a0a4..77f3c6a7d 100644 --- a/d2layouts/d2sequence/layout.go +++ b/d2layouts/d2sequence/layout.go @@ -43,7 +43,7 @@ func Layout(ctx context.Context, g *d2graph.Graph, layout func(ctx context.Conte } obj.Children = make(map[string]*d2graph.Object) obj.ChildrenArray = nil - obj.Box = geo.NewBox(nil, sd.getWidth(), sd.getHeight()) + obj.Box = geo.NewBox(nil, sd.getWidth()+GROUP_CONTAINER_PADDING*2, sd.getHeight()+GROUP_CONTAINER_PADDING*2) obj.LabelPosition = go2.Pointer(string(label.InsideTopCenter)) sequenceDiagrams[obj.AbsID()] = sd @@ -141,14 +141,26 @@ func cleanup(g *d2graph.Graph, sequenceDiagrams map[string]*sequenceDiagram, obj obj.LabelPosition = go2.Pointer(string(label.InsideTopCenter)) sd := sequenceDiagrams[obj.AbsID()] - // shift the sequence diagrams as they are always placed at (0, 0) - sd.shift(obj.TopLeft) + // shift the sequence diagrams as they are always placed at (0, 0) with some padding + sd.shift( + geo.NewPoint( + obj.TopLeft.X+GROUP_CONTAINER_PADDING, + obj.TopLeft.Y+GROUP_CONTAINER_PADDING, + ), + ) obj.Children = make(map[string]*d2graph.Object) + obj.ChildrenArray = make([]*d2graph.Object, 0) for _, child := range sd.actors { obj.Children[child.ID] = child + obj.ChildrenArray = append(obj.ChildrenArray, child) + } + for _, child := range sd.groups { + if child.Parent == obj { + obj.Children[child.ID] = child + obj.ChildrenArray = append(obj.ChildrenArray, child) + } } - obj.ChildrenArray = sd.actors g.Edges = append(g.Edges, sequenceDiagrams[obj.AbsID()].messages...) g.Edges = append(g.Edges, sequenceDiagrams[obj.AbsID()].lifelines...) diff --git a/d2renderers/d2svg/d2svg.go b/d2renderers/d2svg/d2svg.go index 6bf9135a9..77214ce3f 100644 --- a/d2renderers/d2svg/d2svg.go +++ b/d2renderers/d2svg/d2svg.go @@ -637,7 +637,7 @@ func drawShape(writer io.Writer, targetShape d2target.Shape) error { targetShape.Pos.X, targetShape.Pos.Y, targetShape.Width, targetShape.Height, style) // TODO should standardize "" to rectangle - case d2target.ShapeRectangle, "": + case d2target.ShapeRectangle, d2target.ShapeSequenceDiagram, "": if targetShape.ThreeDee { fmt.Fprint(writer, render3dRect(targetShape)) } else { diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/board.exp.json index 775f8b93e..2341f4127 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/board.exp.json @@ -5,8 +5,8 @@ "id": "a", "type": "", "pos": { - "x": 0, - "y": 210 + "x": 24, + "y": 234 }, "width": 487, "height": 126, @@ -45,8 +45,8 @@ "id": "c", "type": "", "pos": { - "x": 578, - "y": 50 + "x": 602, + "y": 74 }, "width": 177, "height": 286, @@ -85,8 +85,8 @@ "id": "d", "type": "", "pos": { - "x": 1014, - "y": 210 + "x": 1038, + "y": 234 }, "width": 150, "height": 126, @@ -125,8 +125,8 @@ "id": "e", "type": "", "pos": { - "x": 1460, - "y": 210 + "x": 1484, + "y": 234 }, "width": 180, "height": 126, @@ -165,8 +165,8 @@ "id": "b", "type": "", "pos": { - "x": 1718, - "y": 210 + "x": 1742, + "y": 234 }, "width": 163, "height": 126, @@ -205,8 +205,8 @@ "id": "f", "type": "", "pos": { - "x": 1931, - "y": 210 + "x": 1955, + "y": 234 }, "width": 561, "height": 126, @@ -269,12 +269,12 @@ "labelPercentage": 0, "route": [ { - "x": 243.5, - "y": 466 + "x": 267.5, + "y": 490 }, { - "x": 1799.5, - "y": 466 + "x": 1823.5, + "y": 490 } ], "animated": false, @@ -308,12 +308,12 @@ "labelPercentage": 0, "route": [ { - "x": 243.5, - "y": 596 + "x": 267.5, + "y": 620 }, { - "x": 1799.5, - "y": 596 + "x": 1823.5, + "y": 620 } ], "animated": false, @@ -347,12 +347,12 @@ "labelPercentage": 0, "route": [ { - "x": 666.5, - "y": 726 + "x": 690.5, + "y": 750 }, { - "x": 1089, - "y": 726 + "x": 1113, + "y": 750 } ], "animated": false, @@ -386,12 +386,12 @@ "labelPercentage": 0, "route": [ { - "x": 243.5, - "y": 856 + "x": 267.5, + "y": 880 }, { - "x": 1089, - "y": 856 + "x": 1113, + "y": 880 } ], "animated": false, @@ -425,12 +425,12 @@ "labelPercentage": 0, "route": [ { - "x": 1089, - "y": 986 + "x": 1113, + "y": 1010 }, { - "x": 1550, - "y": 986 + "x": 1574, + "y": 1010 } ], "animated": false, @@ -464,12 +464,12 @@ "labelPercentage": 0, "route": [ { - "x": 243.5, - "y": 1116 + "x": 267.5, + "y": 1140 }, { - "x": 2211.5, - "y": 1116 + "x": 2235.5, + "y": 1140 } ], "animated": false, @@ -503,12 +503,12 @@ "labelPercentage": 0, "route": [ { - "x": 243.5, - "y": 336 + "x": 267.5, + "y": 360 }, { - "x": 243.5, - "y": 1246 + "x": 267.5, + "y": 1270 } ], "animated": false, @@ -542,12 +542,12 @@ "labelPercentage": 0, "route": [ { - "x": 666.5, - "y": 336 + "x": 690.5, + "y": 360 }, { - "x": 666.5, - "y": 1246 + "x": 690.5, + "y": 1270 } ], "animated": false, @@ -581,12 +581,12 @@ "labelPercentage": 0, "route": [ { - "x": 1089, - "y": 336 + "x": 1113, + "y": 360 }, { - "x": 1089, - "y": 1246 + "x": 1113, + "y": 1270 } ], "animated": false, @@ -620,12 +620,12 @@ "labelPercentage": 0, "route": [ { - "x": 1550, - "y": 336 + "x": 1574, + "y": 360 }, { - "x": 1550, - "y": 1246 + "x": 1574, + "y": 1270 } ], "animated": false, @@ -659,12 +659,12 @@ "labelPercentage": 0, "route": [ { - "x": 1799.5, - "y": 336 + "x": 1823.5, + "y": 360 }, { - "x": 1799.5, - "y": 1246 + "x": 1823.5, + "y": 1270 } ], "animated": false, @@ -698,12 +698,12 @@ "labelPercentage": 0, "route": [ { - "x": 2211.5, - "y": 336 + "x": 2235.5, + "y": 360 }, { - "x": 2211.5, - "y": 1246 + "x": 2235.5, + "y": 1270 } ], "animated": false, diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/sketch.exp.svg index a2518e2ba..0e9876acc 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/sketch.exp.svg @@ -2,7 +2,7 @@ an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long - - - - - + + + + + an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long - - - - - + + + + + a labelblabelsa class+ -public() bool -void- -private() int -voidcloudyyyya := 5 +a labelblabelsa class+ +public() bool +void- +private() int +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid -int -name -varchar - result := callThisFunction(obj, 5) midthis sideother side +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +int +name +varchar + result := callThisFunction(obj, 5) midthis sideother side - - + + a labelblabelsa class+ -public() bool -void- -private() int -voidcloudyyyya := 5 +a labelblabelsa class+ +public() bool +void- +private() int +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid -int -name -varchar - result := callThisFunction(obj, 5) midthis sideother side +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +int +name +varchar + result := callThisFunction(obj, 5) midthis sideother side - - + + abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note - - - - - +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note + + + + + abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note - - - - - +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note + + + + + ba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnoteherescoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier - + abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier - + How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place - - - - - - - - - - - - - - +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place + + + + + + + + + + + + + + How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place - - - - - - - - - - - - - - +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place + + + + + + + + + + + + + + ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor - - - - - - + + + + + + ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor - - - - - - + + + + + + AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response - - - - - - - - + + + + + + + + AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response - - - - - - - - + + + + + + + + scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - + + + + + + + + + + + + scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - + + + + + + + + + + + + a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - - - - - - - - - - - - - +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + + + + + + + + + + + + + a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - - - - - - - - - - - - - +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + + + + + + + + + + + + + bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note - +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note + diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json index 42ec43bf8..00aca25ac 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json @@ -165,8 +165,8 @@ "id": "ggg", "type": "", "pos": { - "x": 25, - "y": 396 + "x": 49, + "y": 420 }, "width": 350, "height": 80, @@ -204,8 +204,8 @@ "id": "group 1", "type": "", "pos": { - "x": 251, - "y": 526 + "x": 275, + "y": 550 }, "width": 398, "height": 730, @@ -243,8 +243,8 @@ "id": "group 1.nested guy", "type": "", "pos": { - "x": 275, - "y": 786 + "x": 299, + "y": 810 }, "width": 350, "height": 80, @@ -282,8 +282,8 @@ "id": "group b", "type": "", "pos": { - "x": 275, - "y": 1306 + "x": 299, + "y": 1330 }, "width": 468, "height": 466, @@ -321,8 +321,8 @@ "id": "c.what would arnold say", "type": "rectangle", "pos": { - "x": 446, - "y": 1476 + "x": 470, + "y": 1500 }, "width": 257, "height": 126, @@ -361,8 +361,8 @@ "id": "choo", "type": "", "pos": { - "x": 693, - "y": 1822 + "x": 717, + "y": 1846 }, "width": 254, "height": 216, @@ -400,8 +400,8 @@ "id": "d.this note", "type": "rectangle", "pos": { - "x": 743, - "y": 1862 + "x": 767, + "y": 1886 }, "width": 164, "height": 126, diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg index 0016febae..baad6e566 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg @@ -2,7 +2,7 @@ abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note + diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json index c88a71bf9..d423c7d1d 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json @@ -45,8 +45,8 @@ "id": "b.note", "type": "rectangle", "pos": { - "x": -187, - "y": 436 + "x": -163, + "y": 460 }, "width": 525, "height": 126, @@ -125,8 +125,8 @@ "id": "a.note", "type": "rectangle", "pos": { - "x": 319, - "y": 692 + "x": 343, + "y": 716 }, "width": 137, "height": 190, diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg index d745a335b..e341c6b43 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg @@ -2,7 +2,7 @@ abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json index e4d793745..39b144a5b 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json @@ -325,8 +325,8 @@ "id": "How this is rendered.d2compiler.measurements also take place", "type": "rectangle", "pos": { - "x": 421, - "y": 732 + "x": 457, + "y": 768 }, "width": 307, "height": 126, @@ -365,8 +365,8 @@ "id": "How this is rendered.only if root is not sequence", "type": "", "pos": { - "x": 781, - "y": 1338 + "x": 817, + "y": 1374 }, "width": 1365, "height": 80, diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg index ad5662304..f2f4d06d7 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2447" height="2536" viewBox="-88 -88 2447 2536">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json index 1c9c641a1..bf9dc2e70 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json @@ -125,8 +125,8 @@ "id": "this is a message group", "type": "", "pos": { - "x": -71, - "y": 396 + "x": -47, + "y": 420 }, "width": 542, "height": 696, @@ -164,8 +164,8 @@ "id": "this is a message group.and this is a nested message group", "type": "", "pos": { - "x": -47, - "y": 526 + "x": -23, + "y": 550 }, "width": 494, "height": 542, @@ -203,8 +203,8 @@ "id": "this is a message group.and this is a nested message group.what about more nesting", "type": "", "pos": { - "x": -23, - "y": 656 + "x": 1, + "y": 680 }, "width": 446, "height": 388, @@ -242,8 +242,8 @@ "id": "this is a message group.and this is a nested message group.what about more nesting.yo", "type": "", "pos": { - "x": 1, - "y": 786 + "x": 25, + "y": 810 }, "width": 398, "height": 234, @@ -281,8 +281,8 @@ "id": "this is a message group.and this is a nested message group.what about more nesting.yo.yo", "type": "", "pos": { - "x": 25, - "y": 916 + "x": 49, + "y": 940 }, "width": 350, "height": 80, diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg index c17ac7f6f..45f3f9430 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg @@ -2,7 +2,7 @@ ab hello ab hello +ab hello rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud cba * cba * ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* abcdefghijklmno abcdefghijklmno aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos1/elk/board.exp.json b/e2etests/testdata/stable/chaos1/elk/board.exp.json index d7fcac07d..8372dc96c 100644 --- a/e2etests/testdata/stable/chaos1/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos1/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg index 62b3bffda..3579dbca5 100644 --- a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="630" height="869" viewBox="-88 -88 630 869">aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos2/dagre/board.exp.json b/e2etests/testdata/stable/chaos2/dagre/board.exp.json index c928b6a24..508c2ef0a 100644 --- a/e2etests/testdata/stable/chaos2/dagre/board.exp.json +++ b/e2etests/testdata/stable/chaos2/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg index 06d891441..4b58359f7 100644 --- a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg @@ -774,8 +774,8 @@ width="1317" height="1854" viewBox="-100 -100 1317 1854">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/chaos2/elk/board.exp.json b/e2etests/testdata/stable/chaos2/elk/board.exp.json index 1aa503f04..31a4ce86a 100644 --- a/e2etests/testdata/stable/chaos2/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos2/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg index 174d4500f..d44e03424 100644 --- a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg @@ -774,8 +774,8 @@ width="1092" height="1907" viewBox="-88 -88 1092 1907">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json index 0ba6c70e2..00b6ab18a 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg index 89f73af80..712788c3f 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="724" height="626" viewBox="-100 -100 724 626">abcd abcd abcd abcd abc abc abc abc acfbdhg acfbdhg acfbdhg acfbdhg agdfbhec agdfbhec agdfbhec agdfbhec abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot bacde21345abcde bacde21345abcde bacde21345abcde bacde21345abcde alphabeta gamma +alphabeta gamma alphabeta gamma +alphabeta gamma size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/font_sizes/elk/board.exp.json b/e2etests/testdata/stable/font_sizes/elk/board.exp.json index 2d5446e61..fbbabd15f 100644 --- a/e2etests/testdata/stable/font_sizes/elk/board.exp.json +++ b/e2etests/testdata/stable/font_sizes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg index 02055f08d..c9d42780f 100644 --- a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1965" height="793" viewBox="-88 -88 1965 793">size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json index 62256201b..297460a3b 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json @@ -53,7 +53,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg index 91b32cb2e..8ed8fda49 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg @@ -1031,7 +1031,7 @@ title for the link, surrounded in quotes. For example:

Code

Unlike a pre-formatted code block, a code span indicates code within a normal paragraph. For example:

-
ab hellohellohellohelloaabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/investigate/elk/board.exp.json b/e2etests/testdata/stable/investigate/elk/board.exp.json index 6e983b96d..70aece788 100644 --- a/e2etests/testdata/stable/investigate/elk/board.exp.json +++ b/e2etests/testdata/stable/investigate/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -505,7 +505,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -836,7 +836,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -876,7 +876,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -916,7 +916,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -996,7 +996,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1036,7 +1036,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1076,7 +1076,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1116,7 +1116,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1156,7 +1156,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1196,7 +1196,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1236,7 +1236,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg index 6655cd820..59d90964e 100644 --- a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="860" height="4868" viewBox="-82 -88 860 4868">aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/large_arch/dagre/board.exp.json b/e2etests/testdata/stable/large_arch/dagre/board.exp.json index f62e8f5a5..c81e7d197 100644 --- a/e2etests/testdata/stable/large_arch/dagre/board.exp.json +++ b/e2etests/testdata/stable/large_arch/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -574,7 +574,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -614,7 +614,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -654,7 +654,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -694,7 +694,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -734,7 +734,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -774,7 +774,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -814,7 +814,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -894,7 +894,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -934,7 +934,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -974,7 +974,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1014,7 +1014,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1054,7 +1054,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1094,7 +1094,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1134,7 +1134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1174,7 +1174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1214,7 +1214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1254,7 +1254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1294,7 +1294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg index 13eab90b5..f3886ef15 100644 --- a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3244" height="1780" viewBox="-100 -100 3244 1780">abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv mixed togethersugarsolution we get +mixed togethersugarsolution we get mixed togethersugarsolution we get +mixed togethersugarsolution we get

Markdown: Syntax

-
ab

Markdown: Syntax

-
ab markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

code

-
ab

code

-
ab thisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesabcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu Foo Baz12hello Foo Baz12hello Foo Baz12hello Foo Baz12hello acdefgbh acdefgbh acdefgbh acdefgbh topabcbottomstartend topabcbottomstartend topabcbottomstartend topabcbottomstartend xyz hello +xyz hello xyz hello +xyz hello an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json index 2341f4127..55a1eec78 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -527,7 +527,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -566,7 +566,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -605,7 +605,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -644,7 +644,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -683,7 +683,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg index 0e9876acc..a46f8c90c 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2692" height="1396" viewBox="-76 -26 2692 1396">an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json index 9f037376a..a32ed6952 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg index b6bd742f3..79f25a284 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json index 9f037376a..a32ed6952 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg index b6bd742f3..79f25a284 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json index 00aca25ac..d6847cc42 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg index baad6e566..9688e4378 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json index 00aca25ac..d6847cc42 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg index baad6e566..9688e4378 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json index d423c7d1d..904780096 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -213,7 +213,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -252,7 +252,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg index e341c6b43..7e9cb62f6 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="850" height="1162" viewBox="-263 -26 850 1162">ba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnoteherescoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json index 39b144a5b..a51050906 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -413,7 +413,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -532,7 +532,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1078,7 +1078,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1117,7 +1117,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1156,7 +1156,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1195,7 +1195,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1234,7 +1234,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1273,7 +1273,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1312,7 +1312,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1351,7 +1351,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1390,7 +1390,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg index f2f4d06d7..b50e4e1a0 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2447" height="2536" viewBox="-88 -88 2447 2536">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json index 76f3e5d4d..a98679802 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -211,7 +211,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg index 72424b802..a415d747a 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json index 76f3e5d4d..a98679802 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -211,7 +211,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg index 72424b802..a415d747a 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json index 1ceb33052..24a642b5f 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg index 14dc4497b..ea3486ab6 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json index 1ceb33052..24a642b5f 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg index 14dc4497b..ea3486ab6 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json index 85ae8a91f..50fdefffc 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -330,7 +330,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg index cb113b131..c61f0cb1b 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json index 85ae8a91f..50fdefffc 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -330,7 +330,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg index cb113b131..c61f0cb1b 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json index b054cf783..cbdb7a97f 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -810,7 +810,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1479,7 +1479,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1950,7 +1950,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2028,7 +2028,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2145,7 +2145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2301,7 +2301,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4161,7 +4161,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4200,7 +4200,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4239,7 +4239,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4278,7 +4278,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4317,7 +4317,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4356,7 +4356,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4395,7 +4395,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4434,7 +4434,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4473,7 +4473,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4512,7 +4512,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4551,7 +4551,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4590,7 +4590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4629,7 +4629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4668,7 +4668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4707,7 +4707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4746,7 +4746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4785,7 +4785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4824,7 +4824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg index 468339af5..eb0b93c75 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3402" height="4269" viewBox="-100 -100 3402 4269">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json index 030b0be63..ed74bde39 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -810,7 +810,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1479,7 +1479,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1950,7 +1950,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2028,7 +2028,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2145,7 +2145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2301,7 +2301,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4080,7 +4080,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4119,7 +4119,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4158,7 +4158,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4197,7 +4197,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4236,7 +4236,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4275,7 +4275,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4314,7 +4314,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4353,7 +4353,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4392,7 +4392,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4431,7 +4431,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4470,7 +4470,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4509,7 +4509,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4548,7 +4548,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4587,7 +4587,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4626,7 +4626,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4665,7 +4665,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4704,7 +4704,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4743,7 +4743,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg index c76a1e7eb..98eabe978 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="3324" height="4389" viewBox="-88 -88 3324 4389">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/square_3d/dagre/board.exp.json b/e2etests/testdata/stable/square_3d/dagre/board.exp.json index 8a037500b..961981fc6 100644 --- a/e2etests/testdata/stable/square_3d/dagre/board.exp.json +++ b/e2etests/testdata/stable/square_3d/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": true, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": true, diff --git a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg index 834d15ac7..536b963fa 100644 --- a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg @@ -20,9 +20,9 @@ width="371" height="580" viewBox="-100 -100 371 580"> -rectangle +rectangle -square -rectangle +rectangle -square acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc AKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDcontainerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json index 35b0e5dd0..f55ea2ba1 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json +++ b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg index df3ac9c7a..a80b6ae79 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="536" height="663" viewBox="-88 -88 536 663">containerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json index f3951de5d..3dddb42bd 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg index bf4b4f2b7..6a50fec38 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="664" height="716" viewBox="-100 -100 664 716">ninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneighteightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json index d012e76be..54a4ee87e 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg index c417a43f7..1b1f29ab4 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="789" height="2014" viewBox="-39 -88 789 2014">eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json index bf9dc2e70..4cf3eda9b 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -563,7 +563,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -602,7 +602,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -641,7 +641,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg index 45f3f9430..96cc12cb0 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="921" height="1242" viewBox="-147 -26 921 1242">bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel abc abc abc abc ab ab ab ab acbd acbd acbd acbd ab hello +ab hello ab hello +ab hello rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud cba * cba * cba * cba * ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* abcdefghijklmno abcdefghijklmno abcdefghijklmno abcdefghijklmno aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos1/elk/board.exp.json b/e2etests/testdata/stable/chaos1/elk/board.exp.json index 8372dc96c..d7fcac07d 100644 --- a/e2etests/testdata/stable/chaos1/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos1/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg index 3579dbca5..62b3bffda 100644 --- a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="630" height="869" viewBox="-88 -88 630 869">aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos2/dagre/board.exp.json b/e2etests/testdata/stable/chaos2/dagre/board.exp.json index 508c2ef0a..c928b6a24 100644 --- a/e2etests/testdata/stable/chaos2/dagre/board.exp.json +++ b/e2etests/testdata/stable/chaos2/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg index 4b58359f7..06d891441 100644 --- a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg @@ -774,8 +774,8 @@ width="1317" height="1854" viewBox="-100 -100 1317 1854">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/chaos2/elk/board.exp.json b/e2etests/testdata/stable/chaos2/elk/board.exp.json index 31a4ce86a..1aa503f04 100644 --- a/e2etests/testdata/stable/chaos2/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos2/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg index d44e03424..174d4500f 100644 --- a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg @@ -774,8 +774,8 @@ width="1092" height="1907" viewBox="-88 -88 1092 1907">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json index 00b6ab18a..0ba6c70e2 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg index 712788c3f..89f73af80 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="724" height="626" viewBox="-100 -100 724 626">abcd abcd abcd abcd abc abc abc abc acfbdhg acfbdhg acfbdhg acfbdhg agdfbhec agdfbhec agdfbhec agdfbhec abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot bacde21345abcde bacde21345abcde bacde21345abcde bacde21345abcde alphabeta gamma +alphabeta gamma alphabeta gamma +alphabeta gamma size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/font_sizes/elk/board.exp.json b/e2etests/testdata/stable/font_sizes/elk/board.exp.json index fbbabd15f..2d5446e61 100644 --- a/e2etests/testdata/stable/font_sizes/elk/board.exp.json +++ b/e2etests/testdata/stable/font_sizes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg index c9d42780f..02055f08d 100644 --- a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1965" height="793" viewBox="-88 -88 1965 793">size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json index 297460a3b..62256201b 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json @@ -53,7 +53,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg index 8ed8fda49..91b32cb2e 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg @@ -1031,7 +1031,7 @@ title for the link, surrounded in quotes. For example:

Code

Unlike a pre-formatted code block, a code span indicates code within a normal paragraph. For example:

-
ab hellohellohellohelloaabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/investigate/elk/board.exp.json b/e2etests/testdata/stable/investigate/elk/board.exp.json index 70aece788..6e983b96d 100644 --- a/e2etests/testdata/stable/investigate/elk/board.exp.json +++ b/e2etests/testdata/stable/investigate/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -505,7 +505,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -836,7 +836,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -876,7 +876,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -916,7 +916,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -996,7 +996,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1036,7 +1036,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1076,7 +1076,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1116,7 +1116,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1156,7 +1156,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1196,7 +1196,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1236,7 +1236,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg index 59d90964e..6655cd820 100644 --- a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="860" height="4868" viewBox="-82 -88 860 4868">aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/large_arch/dagre/board.exp.json b/e2etests/testdata/stable/large_arch/dagre/board.exp.json index c81e7d197..f62e8f5a5 100644 --- a/e2etests/testdata/stable/large_arch/dagre/board.exp.json +++ b/e2etests/testdata/stable/large_arch/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -574,7 +574,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -614,7 +614,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -654,7 +654,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -694,7 +694,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -734,7 +734,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -774,7 +774,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -814,7 +814,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -894,7 +894,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -934,7 +934,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -974,7 +974,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1014,7 +1014,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1054,7 +1054,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1094,7 +1094,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1134,7 +1134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1174,7 +1174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1214,7 +1214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1254,7 +1254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1294,7 +1294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg index f3886ef15..13eab90b5 100644 --- a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3244" height="1780" viewBox="-100 -100 3244 1780">abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv mixed togethersugarsolution we get +mixed togethersugarsolution we get mixed togethersugarsolution we get +mixed togethersugarsolution we get

Markdown: Syntax

-
ab

Markdown: Syntax

-
ab markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

code

-
ab

code

-
ab thisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesabcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu Foo Baz12hello Foo Baz12hello Foo Baz12hello Foo Baz12hello acdefgbh acdefgbh acdefgbh acdefgbh topabcbottomstartend topabcbottomstartend topabcbottomstartend topabcbottomstartend xyz hello +xyz hello xyz hello +xyz hello an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json index 55a1eec78..2341f4127 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -527,7 +527,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -566,7 +566,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -605,7 +605,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -644,7 +644,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -683,7 +683,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg index a46f8c90c..0e9876acc 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2692" height="1396" viewBox="-76 -26 2692 1396">an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json index a32ed6952..9f037376a 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg index 79f25a284..b6bd742f3 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json index a32ed6952..9f037376a 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg index 79f25a284..b6bd742f3 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json index d6847cc42..bf7d446c6 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg index 9688e4378..225993ad1 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json index d6847cc42..bf7d446c6 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg index 9688e4378..225993ad1 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json index 904780096..d423c7d1d 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -213,7 +213,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -252,7 +252,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg index 7e9cb62f6..e341c6b43 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="850" height="1162" viewBox="-263 -26 850 1162">ba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnoteherescoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json index a51050906..39b144a5b 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -413,7 +413,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -532,7 +532,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1078,7 +1078,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1117,7 +1117,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1156,7 +1156,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1195,7 +1195,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1234,7 +1234,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1273,7 +1273,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1312,7 +1312,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1351,7 +1351,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1390,7 +1390,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg index b50e4e1a0..f2f4d06d7 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2447" height="2536" viewBox="-88 -88 2447 2536">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json index a98679802..72a7057a3 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg index a415d747a..7908c57da 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json index a98679802..72a7057a3 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg index a415d747a..7908c57da 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json index 24a642b5f..1ceb33052 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg index ea3486ab6..14dc4497b 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json index 24a642b5f..1ceb33052 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg index ea3486ab6..14dc4497b 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json index 50fdefffc..d63c990f4 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg index c61f0cb1b..f91003569 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json index 50fdefffc..d63c990f4 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg index c61f0cb1b..f91003569 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json index cbdb7a97f..e6fd7e966 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4161,7 +4161,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4200,7 +4200,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4239,7 +4239,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4278,7 +4278,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4317,7 +4317,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4356,7 +4356,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4395,7 +4395,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4434,7 +4434,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4473,7 +4473,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4512,7 +4512,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4551,7 +4551,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4590,7 +4590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4629,7 +4629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4668,7 +4668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4707,7 +4707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4746,7 +4746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4785,7 +4785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4824,7 +4824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg index eb0b93c75..5b7b87c12 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3402" height="4269" viewBox="-100 -100 3402 4269">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json index ed74bde39..7962381f1 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4080,7 +4080,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4119,7 +4119,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4158,7 +4158,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4197,7 +4197,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4236,7 +4236,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4275,7 +4275,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4314,7 +4314,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4353,7 +4353,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4392,7 +4392,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4431,7 +4431,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4470,7 +4470,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4509,7 +4509,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4548,7 +4548,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4587,7 +4587,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4626,7 +4626,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4665,7 +4665,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4704,7 +4704,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4743,7 +4743,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg index 98eabe978..515cfa72d 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="3324" height="4389" viewBox="-88 -88 3324 4389">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/square_3d/dagre/board.exp.json b/e2etests/testdata/stable/square_3d/dagre/board.exp.json index 961981fc6..8a037500b 100644 --- a/e2etests/testdata/stable/square_3d/dagre/board.exp.json +++ b/e2etests/testdata/stable/square_3d/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": true, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": true, diff --git a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg index 536b963fa..834d15ac7 100644 --- a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg @@ -20,9 +20,9 @@ width="371" height="580" viewBox="-100 -100 371 580"> -rectangle +rectangle -square -rectangle +rectangle -square acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc AKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDcontainerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json index f55ea2ba1..35b0e5dd0 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json +++ b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg index a80b6ae79..df3ac9c7a 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="536" height="663" viewBox="-88 -88 536 663">containerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json index 3dddb42bd..f3951de5d 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg index 6a50fec38..bf4b4f2b7 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="664" height="716" viewBox="-100 -100 664 716">ninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneighteightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json index 54a4ee87e..d012e76be 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg index 1b1f29ab4..c417a43f7 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="789" height="2014" viewBox="-39 -88 789 2014">eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json index 4cf3eda9b..bf9dc2e70 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -563,7 +563,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -602,7 +602,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -641,7 +641,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg index 96cc12cb0..45f3f9430 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="921" height="1242" viewBox="-147 -26 921 1242">bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel abc abc abc abc ab ab ab ab acbd acbd acbd acbd ab hello +ab hello ab hello +ab hello rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud cba * cba * cba * cba * ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* abcdefghijklmno abcdefghijklmno abcdefghijklmno abcdefghijklmno aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos1/elk/board.exp.json b/e2etests/testdata/stable/chaos1/elk/board.exp.json index d7fcac07d..592be572b 100644 --- a/e2etests/testdata/stable/chaos1/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos1/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg index 62b3bffda..8434d13b9 100644 --- a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="630" height="869" viewBox="-88 -88 630 869">aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos2/dagre/board.exp.json b/e2etests/testdata/stable/chaos2/dagre/board.exp.json index c928b6a24..c48e2c6ea 100644 --- a/e2etests/testdata/stable/chaos2/dagre/board.exp.json +++ b/e2etests/testdata/stable/chaos2/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg index 06d891441..e557f8e3d 100644 --- a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg @@ -774,8 +774,8 @@ width="1317" height="1854" viewBox="-100 -100 1317 1854">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/chaos2/elk/board.exp.json b/e2etests/testdata/stable/chaos2/elk/board.exp.json index 1aa503f04..b4ecab40f 100644 --- a/e2etests/testdata/stable/chaos2/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos2/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg index 174d4500f..5025c844b 100644 --- a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg @@ -774,8 +774,8 @@ width="1092" height="1907" viewBox="-88 -88 1092 1907">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json index 0ba6c70e2..1f3b3d8ea 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg index 89f73af80..e1f282145 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="724" height="626" viewBox="-100 -100 724 626">abcd abcd abcd abcd abc abc abc abc acfbdhg acfbdhg acfbdhg acfbdhg agdfbhec agdfbhec agdfbhec agdfbhec abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot bacde21345abcde bacde21345abcde bacde21345abcde bacde21345abcde alphabeta gamma +alphabeta gamma alphabeta gamma +alphabeta gamma size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/font_sizes/elk/board.exp.json b/e2etests/testdata/stable/font_sizes/elk/board.exp.json index 2d5446e61..498da91ca 100644 --- a/e2etests/testdata/stable/font_sizes/elk/board.exp.json +++ b/e2etests/testdata/stable/font_sizes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg index 02055f08d..fd230f08e 100644 --- a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1965" height="793" viewBox="-88 -88 1965 793">size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json index 62256201b..904218a42 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json @@ -53,7 +53,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg index 91b32cb2e..153ac2cc0 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg @@ -1031,7 +1031,7 @@ title for the link, surrounded in quotes. For example:

Code

Unlike a pre-formatted code block, a code span indicates code within a normal paragraph. For example:

-
ab hellohellohellohelloaabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/investigate/elk/board.exp.json b/e2etests/testdata/stable/investigate/elk/board.exp.json index 6e983b96d..d7887cee8 100644 --- a/e2etests/testdata/stable/investigate/elk/board.exp.json +++ b/e2etests/testdata/stable/investigate/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -505,7 +505,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -836,7 +836,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -876,7 +876,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -916,7 +916,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -996,7 +996,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1036,7 +1036,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1076,7 +1076,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1116,7 +1116,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1156,7 +1156,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1196,7 +1196,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1236,7 +1236,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg index 6655cd820..07d7c9369 100644 --- a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="860" height="4868" viewBox="-82 -88 860 4868">aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/large_arch/dagre/board.exp.json b/e2etests/testdata/stable/large_arch/dagre/board.exp.json index f62e8f5a5..86ef27a13 100644 --- a/e2etests/testdata/stable/large_arch/dagre/board.exp.json +++ b/e2etests/testdata/stable/large_arch/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -574,7 +574,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -614,7 +614,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -654,7 +654,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -694,7 +694,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -734,7 +734,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -774,7 +774,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -814,7 +814,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -894,7 +894,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -934,7 +934,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -974,7 +974,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1014,7 +1014,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1054,7 +1054,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1094,7 +1094,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1134,7 +1134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1174,7 +1174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1214,7 +1214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1254,7 +1254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1294,7 +1294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg index 13eab90b5..24bbbf19c 100644 --- a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3244" height="1780" viewBox="-100 -100 3244 1780">abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv mixed togethersugarsolution we get +mixed togethersugarsolution we get mixed togethersugarsolution we get +mixed togethersugarsolution we get

Markdown: Syntax

-
ab

Markdown: Syntax

-
ab markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

code

-
ab

code

-
ab thisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesabcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu Foo Baz12hello Foo Baz12hello Foo Baz12hello Foo Baz12hello acdefgbh acdefgbh acdefgbh acdefgbh topabcbottomstartend topabcbottomstartend topabcbottomstartend topabcbottomstartend xyz hello +xyz hello xyz hello +xyz hello an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json index 2341f4127..c110ffb9f 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -527,7 +527,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -566,7 +566,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -605,7 +605,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -644,7 +644,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -683,7 +683,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg index 0e9876acc..b23e2a894 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2692" height="1396" viewBox="-76 -26 2692 1396">an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json index 9f037376a..5ba5188b6 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg index b6bd742f3..d62bed291 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json index 9f037376a..5ba5188b6 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg index b6bd742f3..d62bed291 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json index bf7d446c6..46189a44c 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg index 225993ad1..d5d6aea8d 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json index bf7d446c6..46189a44c 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg index 225993ad1..d5d6aea8d 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json index d423c7d1d..ab449d330 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -213,7 +213,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -252,7 +252,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg index e341c6b43..1df8c0fea 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="850" height="1162" viewBox="-263 -26 850 1162">ba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnoteherescoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json index 39b144a5b..3c78207a7 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -413,7 +413,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -532,7 +532,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1078,7 +1078,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1117,7 +1117,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1156,7 +1156,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1195,7 +1195,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1234,7 +1234,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1273,7 +1273,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1312,7 +1312,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1351,7 +1351,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1390,7 +1390,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg index f2f4d06d7..84952ba2c 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2447" height="2536" viewBox="-88 -88 2447 2536">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json index 72a7057a3..6280730ef 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg index 7908c57da..acfa44a0f 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json index 72a7057a3..6280730ef 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg index 7908c57da..acfa44a0f 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json index 1ceb33052..61a83ea65 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg index 14dc4497b..514a06e0b 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json index 1ceb33052..61a83ea65 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg index 14dc4497b..514a06e0b 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json index d63c990f4..953ad57aa 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg index f91003569..8ab955b0b 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json index d63c990f4..953ad57aa 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg index f91003569..8ab955b0b 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json index e6fd7e966..7504a4d75 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4161,7 +4161,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4200,7 +4200,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4239,7 +4239,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4278,7 +4278,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4317,7 +4317,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4356,7 +4356,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4395,7 +4395,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4434,7 +4434,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4473,7 +4473,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4512,7 +4512,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4551,7 +4551,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4590,7 +4590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4629,7 +4629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4668,7 +4668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4707,7 +4707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4746,7 +4746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4785,7 +4785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4824,7 +4824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg index 5b7b87c12..fb00ca94b 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3402" height="4269" viewBox="-100 -100 3402 4269">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json index 7962381f1..a928d0fb8 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4080,7 +4080,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4119,7 +4119,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4158,7 +4158,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4197,7 +4197,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4236,7 +4236,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4275,7 +4275,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4314,7 +4314,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4353,7 +4353,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4392,7 +4392,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4431,7 +4431,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4470,7 +4470,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4509,7 +4509,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4548,7 +4548,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4587,7 +4587,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4626,7 +4626,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4665,7 +4665,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4704,7 +4704,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4743,7 +4743,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg index 515cfa72d..b8810283a 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="3324" height="4389" viewBox="-88 -88 3324 4389">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/square_3d/dagre/board.exp.json b/e2etests/testdata/stable/square_3d/dagre/board.exp.json index 8a037500b..ae0b398cd 100644 --- a/e2etests/testdata/stable/square_3d/dagre/board.exp.json +++ b/e2etests/testdata/stable/square_3d/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": true, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": true, diff --git a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg index 834d15ac7..8070f9471 100644 --- a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg @@ -20,9 +20,9 @@ width="371" height="580" viewBox="-100 -100 371 580"> -rectangle +rectangle -square -rectangle +rectangle -square acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc AKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDcontainerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json index 35b0e5dd0..aec76c448 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json +++ b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg index df3ac9c7a..e2c86e47a 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="536" height="663" viewBox="-88 -88 536 663">containerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json index f3951de5d..c36a465ab 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg index bf4b4f2b7..5dda9ae06 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="664" height="716" viewBox="-100 -100 664 716">ninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneighteightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json index d012e76be..dae1aff5b 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg index c417a43f7..f42b3ddce 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="789" height="2014" viewBox="-39 -88 789 2014">eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json index bf9dc2e70..8e5611289 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -563,7 +563,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -602,7 +602,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -641,7 +641,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg index 45f3f9430..e9cb1975f 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="921" height="1242" viewBox="-147 -26 921 1242">bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json index 46189a44c..5f4deb35f 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg index d5d6aea8d..e70cbbc29 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/board.exp.json index 9637cd1a8..c07125eea 100644 --- a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/board.exp.json @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -330,7 +330,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -408,7 +408,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -487,7 +487,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -526,7 +526,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -565,7 +565,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -683,7 +683,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -722,7 +722,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -761,7 +761,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -878,7 +878,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg index aa51c655e..537ab773d 100644 --- a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="1626" viewBox="-76 -26 1624 1626">scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json index 3c78207a7..489789116 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json @@ -413,7 +413,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -532,7 +532,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg index 84952ba2c..c229cf631 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2447" height="2536" viewBox="-88 -88 2447 2536">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json index 6280730ef..95bd3ecee 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -211,7 +211,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg index acfa44a0f..516abbea1 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json index 6280730ef..95bd3ecee 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -211,7 +211,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg index acfa44a0f..516abbea1 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json index 953ad57aa..00c75c1a9 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -330,7 +330,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg index 8ab955b0b..9a2b4dca8 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json index 953ad57aa..00c75c1a9 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -330,7 +330,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg index 8ab955b0b..9a2b4dca8 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json index 7504a4d75..a87c5874a 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -810,7 +810,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1479,7 +1479,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1950,7 +1950,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2028,7 +2028,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2067,7 +2067,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2145,7 +2145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2184,7 +2184,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2301,7 +2301,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2340,7 +2340,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg index fb00ca94b..fab9122c5 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3402" height="4269" viewBox="-100 -100 3402 4269">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json index a928d0fb8..93a2f4d96 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -810,7 +810,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1479,7 +1479,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1950,7 +1950,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2028,7 +2028,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2067,7 +2067,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2145,7 +2145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2184,7 +2184,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2301,7 +2301,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2340,7 +2340,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg index b8810283a..b5128161a 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="3324" height="4389" viewBox="-88 -88 3324 4389">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) From d90eb355d3432731a6b9822573400b04d084164f Mon Sep 17 00:00:00 2001 From: Alexander Wang Date: Mon, 5 Dec 2022 14:30:40 -0800 Subject: [PATCH 7/8] prs --- d2exporter/export.go | 3 +-- d2graph/d2graph.go | 6 +++--- d2layouts/d2sequence/layout.go | 2 +- 3 files changed, 5 insertions(+), 6 deletions(-) diff --git a/d2exporter/export.go b/d2exporter/export.go index d39831a2e..1f2a15b8d 100644 --- a/d2exporter/export.go +++ b/d2exporter/export.go @@ -3,7 +3,6 @@ package d2exporter import ( "context" "strconv" - "strings" "oss.terrastruct.com/d2/d2graph" "oss.terrastruct.com/d2/d2target" @@ -100,7 +99,7 @@ func toShape(obj *d2graph.Object, theme *d2themes.Theme) d2target.Shape { shape.Italic = text.IsItalic shape.FontSize = text.FontSize - if strings.EqualFold(obj.Attributes.Shape.Value, d2target.ShapeSequenceDiagram) { + if obj.IsSequenceDiagram() { shape.StrokeWidth = 0 } diff --git a/d2graph/d2graph.go b/d2graph/d2graph.go index 3766d6d92..b7af9f2a3 100644 --- a/d2graph/d2graph.go +++ b/d2graph/d2graph.go @@ -343,12 +343,12 @@ func (obj *Object) GetFill(theme *d2themes.Theme) string { return theme.Colors.Neutrals.N7 } - shape := obj.Attributes.Shape.Value - - if strings.EqualFold(shape, d2target.ShapeSequenceDiagram) { + if obj.IsSequenceDiagram() { return theme.Colors.Neutrals.N7 } + shape := obj.Attributes.Shape.Value + if shape == "" || strings.EqualFold(shape, d2target.ShapeSquare) || strings.EqualFold(shape, d2target.ShapeCircle) || strings.EqualFold(shape, d2target.ShapeOval) || strings.EqualFold(shape, d2target.ShapeRectangle) { if level == 1 { if !obj.IsContainer() { diff --git a/d2layouts/d2sequence/layout.go b/d2layouts/d2sequence/layout.go index 77f3c6a7d..6a9498642 100644 --- a/d2layouts/d2sequence/layout.go +++ b/d2layouts/d2sequence/layout.go @@ -156,7 +156,7 @@ func cleanup(g *d2graph.Graph, sequenceDiagrams map[string]*sequenceDiagram, obj obj.ChildrenArray = append(obj.ChildrenArray, child) } for _, child := range sd.groups { - if child.Parent == obj { + if child.Parent.AbsID() == obj.AbsID() { obj.Children[child.ID] = child obj.ChildrenArray = append(obj.ChildrenArray, child) } From 9e523015bf8dc8f16903c6f819138094fda876cb Mon Sep 17 00:00:00 2001 From: Alexander Wang Date: Mon, 5 Dec 2022 14:40:14 -0800 Subject: [PATCH 8/8] rever theme change for now --- d2themes/d2themescatalog/default.go | 20 +-- e2etests/stable_test.go | 3 +- .../sanity/1_to_2/dagre/board.exp.json | 6 +- .../sanity/1_to_2/dagre/sketch.exp.svg | 2 +- .../testdata/sanity/1_to_2/elk/board.exp.json | 6 +- .../testdata/sanity/1_to_2/elk/sketch.exp.svg | 2 +- .../sanity/basic/dagre/board.exp.json | 4 +- .../sanity/basic/dagre/sketch.exp.svg | 2 +- .../testdata/sanity/basic/elk/board.exp.json | 4 +- .../testdata/sanity/basic/elk/sketch.exp.svg | 2 +- .../child_to_child/dagre/board.exp.json | 8 +- .../child_to_child/dagre/sketch.exp.svg | 2 +- .../sanity/child_to_child/elk/board.exp.json | 8 +- .../sanity/child_to_child/elk/sketch.exp.svg | 2 +- .../connection_label/dagre/board.exp.json | 4 +- .../connection_label/dagre/sketch.exp.svg | 2 +- .../connection_label/elk/board.exp.json | 4 +- .../connection_label/elk/sketch.exp.svg | 2 +- .../stable/all_shapes/dagre/board.exp.json | 22 +-- .../stable/all_shapes/dagre/sketch.exp.svg | 2 +- .../stable/all_shapes/elk/board.exp.json | 22 +-- .../stable/all_shapes/elk/sketch.exp.svg | 2 +- .../all_shapes_multiple/dagre/board.exp.json | 22 +-- .../all_shapes_multiple/dagre/sketch.exp.svg | 2 +- .../all_shapes_multiple/elk/board.exp.json | 22 +-- .../all_shapes_multiple/elk/sketch.exp.svg | 2 +- .../all_shapes_shadow/dagre/board.exp.json | 22 +-- .../all_shapes_shadow/dagre/sketch.exp.svg | 2 +- .../all_shapes_shadow/elk/board.exp.json | 22 +-- .../all_shapes_shadow/elk/sketch.exp.svg | 2 +- .../arrowhead_adjustment/dagre/board.exp.json | 10 +- .../arrowhead_adjustment/dagre/sketch.exp.svg | 2 +- .../arrowhead_adjustment/elk/board.exp.json | 10 +- .../arrowhead_adjustment/elk/sketch.exp.svg | 2 +- .../arrowhead_labels/dagre/board.exp.json | 4 +- .../arrowhead_labels/dagre/sketch.exp.svg | 2 +- .../arrowhead_labels/elk/board.exp.json | 4 +- .../arrowhead_labels/elk/sketch.exp.svg | 2 +- .../stable/binary_tree/dagre/board.exp.json | 30 ++-- .../stable/binary_tree/dagre/sketch.exp.svg | 2 +- .../stable/binary_tree/elk/board.exp.json | 30 ++-- .../stable/binary_tree/elk/sketch.exp.svg | 2 +- .../stable/chaos1/dagre/board.exp.json | 8 +- .../stable/chaos1/dagre/sketch.exp.svg | 2 +- .../testdata/stable/chaos1/elk/board.exp.json | 8 +- .../testdata/stable/chaos1/elk/sketch.exp.svg | 2 +- .../stable/chaos2/dagre/board.exp.json | 16 +- .../stable/chaos2/dagre/sketch.exp.svg | 4 +- .../testdata/stable/chaos2/elk/board.exp.json | 16 +- .../testdata/stable/chaos2/elk/sketch.exp.svg | 4 +- .../child_parent_edges/dagre/board.exp.json | 6 +- .../child_parent_edges/dagre/sketch.exp.svg | 2 +- .../child_parent_edges/elk/board.exp.json | 6 +- .../child_parent_edges/elk/sketch.exp.svg | 2 +- .../circular_dependency/dagre/board.exp.json | 6 +- .../circular_dependency/dagre/sketch.exp.svg | 2 +- .../circular_dependency/elk/board.exp.json | 6 +- .../circular_dependency/elk/sketch.exp.svg | 2 +- .../stable/code_snippet/dagre/board.exp.json | 4 +- .../stable/code_snippet/dagre/sketch.exp.svg | 2 +- .../stable/code_snippet/elk/board.exp.json | 4 +- .../stable/code_snippet/elk/sketch.exp.svg | 2 +- .../connected_container/dagre/board.exp.json | 14 +- .../connected_container/dagre/sketch.exp.svg | 2 +- .../connected_container/elk/board.exp.json | 14 +- .../connected_container/elk/sketch.exp.svg | 2 +- .../container_edges/dagre/board.exp.json | 16 +- .../container_edges/dagre/sketch.exp.svg | 2 +- .../stable/container_edges/elk/board.exp.json | 16 +- .../stable/container_edges/elk/sketch.exp.svg | 2 +- .../stable/dense/dagre/board.exp.json | 34 ++--- .../stable/dense/dagre/sketch.exp.svg | 2 +- .../testdata/stable/dense/elk/board.exp.json | 34 ++--- .../testdata/stable/dense/elk/sketch.exp.svg | 2 +- .../different_subgraphs/dagre/board.exp.json | 44 +++--- .../different_subgraphs/dagre/sketch.exp.svg | 2 +- .../different_subgraphs/elk/board.exp.json | 44 +++--- .../different_subgraphs/elk/sketch.exp.svg | 2 +- .../stable/direction/dagre/board.exp.json | 30 ++-- .../stable/direction/dagre/sketch.exp.svg | 2 +- .../stable/direction/elk/board.exp.json | 30 ++-- .../stable/direction/elk/sketch.exp.svg | 2 +- .../stable/font_colors/dagre/board.exp.json | 4 +- .../stable/font_colors/dagre/sketch.exp.svg | 2 +- .../stable/font_colors/elk/board.exp.json | 4 +- .../stable/font_colors/elk/sketch.exp.svg | 2 +- .../stable/font_sizes/dagre/board.exp.json | 24 +-- .../stable/font_sizes/dagre/sketch.exp.svg | 2 +- .../stable/font_sizes/elk/board.exp.json | 24 +-- .../stable/font_sizes/elk/sketch.exp.svg | 2 +- .../giant_markdown_test/dagre/board.exp.json | 4 +- .../giant_markdown_test/dagre/sketch.exp.svg | 2 +- .../giant_markdown_test/elk/board.exp.json | 4 +- .../giant_markdown_test/elk/sketch.exp.svg | 2 +- .../testdata/stable/hr/dagre/board.exp.json | 4 +- .../testdata/stable/hr/dagre/sketch.exp.svg | 2 +- .../testdata/stable/hr/elk/board.exp.json | 4 +- .../testdata/stable/hr/elk/sketch.exp.svg | 2 +- .../stable/icon-label/dagre/board.exp.json | 2 +- .../stable/icon-label/dagre/sketch.exp.svg | 2 +- .../stable/icon-label/elk/board.exp.json | 2 +- .../stable/icon-label/elk/sketch.exp.svg | 2 +- .../stable/investigate/dagre/board.exp.json | 50 +++--- .../stable/investigate/dagre/sketch.exp.svg | 2 +- .../stable/investigate/elk/board.exp.json | 50 +++--- .../stable/investigate/elk/sketch.exp.svg | 2 +- .../stable/large_arch/dagre/board.exp.json | 64 ++++---- .../stable/large_arch/dagre/sketch.exp.svg | 2 +- .../stable/large_arch/elk/board.exp.json | 64 ++++---- .../stable/large_arch/elk/sketch.exp.svg | 2 +- .../stable/latex/dagre/board.exp.json | 6 +- .../stable/latex/dagre/sketch.exp.svg | 2 +- .../testdata/stable/latex/elk/board.exp.json | 6 +- .../testdata/stable/latex/elk/sketch.exp.svg | 2 +- .../testdata/stable/li1/dagre/board.exp.json | 4 +- .../testdata/stable/li1/dagre/sketch.exp.svg | 2 +- .../testdata/stable/li1/elk/board.exp.json | 4 +- .../testdata/stable/li1/elk/sketch.exp.svg | 2 +- .../testdata/stable/li2/dagre/board.exp.json | 4 +- .../testdata/stable/li2/dagre/sketch.exp.svg | 2 +- .../testdata/stable/li2/elk/board.exp.json | 4 +- .../testdata/stable/li2/elk/sketch.exp.svg | 2 +- .../testdata/stable/li3/dagre/board.exp.json | 4 +- .../testdata/stable/li3/dagre/sketch.exp.svg | 2 +- .../testdata/stable/li3/elk/board.exp.json | 4 +- .../testdata/stable/li3/elk/sketch.exp.svg | 2 +- .../testdata/stable/li4/dagre/board.exp.json | 4 +- .../testdata/stable/li4/dagre/sketch.exp.svg | 2 +- .../testdata/stable/li4/elk/board.exp.json | 4 +- .../testdata/stable/li4/elk/sketch.exp.svg | 2 +- .../stable/lone_h1/dagre/board.exp.json | 4 +- .../stable/lone_h1/dagre/sketch.exp.svg | 2 +- .../stable/lone_h1/elk/board.exp.json | 4 +- .../stable/lone_h1/elk/sketch.exp.svg | 2 +- .../stable/markdown/dagre/board.exp.json | 4 +- .../stable/markdown/dagre/sketch.exp.svg | 2 +- .../stable/markdown/elk/board.exp.json | 4 +- .../stable/markdown/elk/sketch.exp.svg | 2 +- .../md_2space_newline/dagre/board.exp.json | 2 +- .../md_2space_newline/dagre/sketch.exp.svg | 2 +- .../md_2space_newline/elk/board.exp.json | 2 +- .../md_2space_newline/elk/sketch.exp.svg | 2 +- .../md_backslash_newline/dagre/board.exp.json | 2 +- .../md_backslash_newline/dagre/sketch.exp.svg | 2 +- .../md_backslash_newline/elk/board.exp.json | 2 +- .../md_backslash_newline/elk/sketch.exp.svg | 2 +- .../md_code_block_fenced/dagre/board.exp.json | 4 +- .../md_code_block_fenced/dagre/sketch.exp.svg | 2 +- .../md_code_block_fenced/elk/board.exp.json | 4 +- .../md_code_block_fenced/elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 4 +- .../dagre/sketch.exp.svg | 2 +- .../md_code_block_indented/elk/board.exp.json | 4 +- .../md_code_block_indented/elk/sketch.exp.svg | 2 +- .../md_code_inline/dagre/board.exp.json | 4 +- .../md_code_inline/dagre/sketch.exp.svg | 2 +- .../stable/md_code_inline/elk/board.exp.json | 4 +- .../stable/md_code_inline/elk/sketch.exp.svg | 2 +- .../multiline_text/dagre/board.exp.json | 2 +- .../multiline_text/dagre/sketch.exp.svg | 2 +- .../stable/multiline_text/elk/board.exp.json | 2 +- .../stable/multiline_text/elk/sketch.exp.svg | 2 +- .../multiple_trees/dagre/board.exp.json | 46 +++--- .../multiple_trees/dagre/sketch.exp.svg | 2 +- .../stable/multiple_trees/elk/board.exp.json | 46 +++--- .../stable/multiple_trees/elk/sketch.exp.svg | 2 +- .../stable/n22_e32/dagre/board.exp.json | 42 ++--- .../stable/n22_e32/dagre/sketch.exp.svg | 2 +- .../stable/n22_e32/elk/board.exp.json | 42 ++--- .../stable/n22_e32/elk/sketch.exp.svg | 2 +- .../number_connections/dagre/board.exp.json | 8 +- .../number_connections/dagre/sketch.exp.svg | 2 +- .../number_connections/elk/board.exp.json | 8 +- .../number_connections/elk/sketch.exp.svg | 2 +- .../one_container_loop/dagre/board.exp.json | 16 +- .../one_container_loop/dagre/sketch.exp.svg | 2 +- .../one_container_loop/elk/board.exp.json | 16 +- .../one_container_loop/elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 14 +- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 14 +- .../elk/sketch.exp.svg | 2 +- .../testdata/stable/p/dagre/board.exp.json | 4 +- .../testdata/stable/p/dagre/sketch.exp.svg | 2 +- e2etests/testdata/stable/p/elk/board.exp.json | 4 +- e2etests/testdata/stable/p/elk/sketch.exp.svg | 2 +- .../testdata/stable/pre/dagre/board.exp.json | 4 +- .../testdata/stable/pre/dagre/sketch.exp.svg | 2 +- .../testdata/stable/pre/elk/board.exp.json | 4 +- .../testdata/stable/pre/elk/sketch.exp.svg | 2 +- .../self-referencing/dagre/board.exp.json | 6 +- .../self-referencing/dagre/sketch.exp.svg | 2 +- .../self-referencing/elk/board.exp.json | 6 +- .../self-referencing/elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 24 +-- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 24 +-- .../elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 80 +++++----- .../dagre/sketch.exp.svg | 8 +- .../elk/board.exp.json | 80 +++++----- .../elk/sketch.exp.svg | 8 +- .../dagre/board.exp.json | 22 +-- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 22 +-- .../elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 8 +- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 8 +- .../elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 12 +- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 12 +- .../elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 44 +++--- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 44 +++--- .../elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 16 +- .../dagre/sketch.exp.svg | 2 +- .../sequence_diagram_note/elk/board.exp.json | 16 +- .../sequence_diagram_note/elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 40 ++--- .../dagre/sketch.exp.svg | 2 +- .../sequence_diagram_real/elk/board.exp.json | 40 ++--- .../sequence_diagram_real/elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 18 +-- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 18 +-- .../elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 24 +-- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 24 +-- .../elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 46 +++--- .../dagre/sketch.exp.svg | 2 +- .../sequence_diagram_span/elk/board.exp.json | 46 +++--- .../sequence_diagram_span/elk/sketch.exp.svg | 2 +- .../sequence_diagrams/dagre/board.exp.json | 144 +++++++++--------- .../sequence_diagrams/dagre/sketch.exp.svg | 2 +- .../sequence_diagrams/elk/board.exp.json | 144 +++++++++--------- .../sequence_diagrams/elk/sketch.exp.svg | 2 +- .../stable/square_3d/dagre/board.exp.json | 4 +- .../stable/square_3d/dagre/sketch.exp.svg | 4 +- .../stable/square_3d/elk/board.exp.json | 4 +- .../stable/square_3d/elk/sketch.exp.svg | 4 +- .../dagre/board.exp.json | 50 +++--- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 50 +++--- .../elk/sketch.exp.svg | 2 +- .../stable/us_map/dagre/board.exp.json | 100 ++++++------ .../stable/us_map/dagre/sketch.exp.svg | 2 +- .../testdata/stable/us_map/elk/board.exp.json | 100 ++++++------ .../testdata/stable/us_map/elk/sketch.exp.svg | 2 +- .../container_child_edge/dagre/board.exp.json | 6 +- .../container_child_edge/dagre/sketch.exp.svg | 2 +- .../container_child_edge/elk/board.exp.json | 6 +- .../container_child_edge/elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 6 +- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 6 +- .../elk/sketch.exp.svg | 2 +- .../font_sizes_large/dagre/board.exp.json | 10 +- .../font_sizes_large/dagre/sketch.exp.svg | 2 +- .../todo/font_sizes_large/elk/board.exp.json | 10 +- .../todo/font_sizes_large/elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 12 +- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 12 +- .../elk/sketch.exp.svg | 2 +- .../todo/tall_edge_label/dagre/board.exp.json | 4 +- .../todo/tall_edge_label/dagre/sketch.exp.svg | 2 +- .../todo/tall_edge_label/elk/board.exp.json | 4 +- .../todo/tall_edge_label/elk/sketch.exp.svg | 2 +- 274 files changed, 1478 insertions(+), 1477 deletions(-) diff --git a/d2themes/d2themescatalog/default.go b/d2themes/d2themescatalog/default.go index bd240a16d..6fd3fb878 100644 --- a/d2themes/d2themescatalog/default.go +++ b/d2themes/d2themescatalog/default.go @@ -9,17 +9,17 @@ var NeutralDefault = d2themes.Theme{ Neutrals: d2themes.CoolNeutral, B1: "#0D32B2", - B2: "#2952E4", - B3: "#B0C0FB", - B4: "#D2DBFD", - B5: "#E7EAFF", - B6: "#F4F6FD", + B2: "#0D32B2", + B3: "#E3E9FD", + B4: "#E3E9FD", + B5: "#EDF0FD", + B6: "#F7F8FE", - AA2: "#2952E4", - AA4: "#D2DBFD", - AA5: "#E7EAFF", + AA2: "#4A6FF3", + AA4: "#EDF0FD", + AA5: "#F7F8FE", - AB4: "#D2DBFD", - AB5: "#E7EAFF", + AB4: "#EDF0FD", + AB5: "#F7F8FE", }, } diff --git a/e2etests/stable_test.go b/e2etests/stable_test.go index 22d6b86ec..230528899 100644 --- a/e2etests/stable_test.go +++ b/e2etests/stable_test.go @@ -1451,7 +1451,8 @@ c: "just an actor" d2exporter.export -> CLI: resulting SVG } `, - }, { + }, + { name: "sequence_diagram_actor_distance", script: `shape: sequence_diagram a: "an actor with a really long label that will break everything" diff --git a/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json b/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json index 68718fd35..53c443478 100644 --- a/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json +++ b/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg b/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg index bb1c3505b..d38113b44 100644 --- a/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg +++ b/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="486" height="552" viewBox="-100 -100 486 552">abc abc abc abc ab ab ab ab acbd acbd acbd acbd ab hello +ab hello ab hello +ab hello rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud cba * cba * cba * cba * ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* abcdefghijklmno abcdefghijklmno abcdefghijklmno abcdefghijklmno aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos1/elk/board.exp.json b/e2etests/testdata/stable/chaos1/elk/board.exp.json index 592be572b..d7fcac07d 100644 --- a/e2etests/testdata/stable/chaos1/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos1/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg index 8434d13b9..62b3bffda 100644 --- a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="630" height="869" viewBox="-88 -88 630 869">aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos2/dagre/board.exp.json b/e2etests/testdata/stable/chaos2/dagre/board.exp.json index c48e2c6ea..c928b6a24 100644 --- a/e2etests/testdata/stable/chaos2/dagre/board.exp.json +++ b/e2etests/testdata/stable/chaos2/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg index e557f8e3d..06d891441 100644 --- a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg @@ -774,8 +774,8 @@ width="1317" height="1854" viewBox="-100 -100 1317 1854">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/chaos2/elk/board.exp.json b/e2etests/testdata/stable/chaos2/elk/board.exp.json index b4ecab40f..1aa503f04 100644 --- a/e2etests/testdata/stable/chaos2/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos2/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg index 5025c844b..174d4500f 100644 --- a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg @@ -774,8 +774,8 @@ width="1092" height="1907" viewBox="-88 -88 1092 1907">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json index 1f3b3d8ea..0ba6c70e2 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg index e1f282145..89f73af80 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="724" height="626" viewBox="-100 -100 724 626">abcd abcd abcd abcd abc abc abc abc acfbdhg acfbdhg acfbdhg acfbdhg agdfbhec agdfbhec agdfbhec agdfbhec abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot bacde21345abcde bacde21345abcde bacde21345abcde bacde21345abcde alphabeta gamma +alphabeta gamma alphabeta gamma +alphabeta gamma size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/font_sizes/elk/board.exp.json b/e2etests/testdata/stable/font_sizes/elk/board.exp.json index 498da91ca..2d5446e61 100644 --- a/e2etests/testdata/stable/font_sizes/elk/board.exp.json +++ b/e2etests/testdata/stable/font_sizes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg index fd230f08e..02055f08d 100644 --- a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1965" height="793" viewBox="-88 -88 1965 793">size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json index 904218a42..62256201b 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json @@ -53,7 +53,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg index 153ac2cc0..91b32cb2e 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg @@ -1031,7 +1031,7 @@ title for the link, surrounded in quotes. For example:

Code

Unlike a pre-formatted code block, a code span indicates code within a normal paragraph. For example:

-
ab hellohellohellohelloaabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/investigate/elk/board.exp.json b/e2etests/testdata/stable/investigate/elk/board.exp.json index d7887cee8..6e983b96d 100644 --- a/e2etests/testdata/stable/investigate/elk/board.exp.json +++ b/e2etests/testdata/stable/investigate/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -505,7 +505,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -836,7 +836,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -876,7 +876,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -916,7 +916,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -996,7 +996,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1036,7 +1036,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1076,7 +1076,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1116,7 +1116,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1156,7 +1156,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1196,7 +1196,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1236,7 +1236,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg index 07d7c9369..6655cd820 100644 --- a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="860" height="4868" viewBox="-82 -88 860 4868">aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/large_arch/dagre/board.exp.json b/e2etests/testdata/stable/large_arch/dagre/board.exp.json index 86ef27a13..f62e8f5a5 100644 --- a/e2etests/testdata/stable/large_arch/dagre/board.exp.json +++ b/e2etests/testdata/stable/large_arch/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -574,7 +574,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -614,7 +614,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -654,7 +654,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -694,7 +694,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -734,7 +734,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -774,7 +774,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -814,7 +814,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -894,7 +894,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -934,7 +934,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -974,7 +974,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1014,7 +1014,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1054,7 +1054,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1094,7 +1094,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1134,7 +1134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1174,7 +1174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1214,7 +1214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1254,7 +1254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1294,7 +1294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg index 24bbbf19c..13eab90b5 100644 --- a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3244" height="1780" viewBox="-100 -100 3244 1780">abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv mixed togethersugarsolution we get +mixed togethersugarsolution we get mixed togethersugarsolution we get +mixed togethersugarsolution we get

Markdown: Syntax

-
ab

Markdown: Syntax

-
ab markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

code

-
ab

code

-
ab thisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesabcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu Foo Baz12hello Foo Baz12hello Foo Baz12hello Foo Baz12hello acdefgbh acdefgbh acdefgbh acdefgbh topabcbottomstartend topabcbottomstartend topabcbottomstartend topabcbottomstartend xyz hello +xyz hello xyz hello +xyz hello an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json index c110ffb9f..2341f4127 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -527,7 +527,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -566,7 +566,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -605,7 +605,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -644,7 +644,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -683,7 +683,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg index b23e2a894..0e9876acc 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2692" height="1396" viewBox="-76 -26 2692 1396">an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json index 5ba5188b6..9f037376a 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg index d62bed291..b6bd742f3 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json index 5ba5188b6..9f037376a 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg index d62bed291..b6bd742f3 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json index 5f4deb35f..3fd82835d 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg index e70cbbc29..ec8e7b216 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json index 5f4deb35f..3fd82835d 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg index e70cbbc29..ec8e7b216 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json index ab449d330..d423c7d1d 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -213,7 +213,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -252,7 +252,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg index 1df8c0fea..e341c6b43 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="850" height="1162" viewBox="-263 -26 850 1162">ba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnoteherescoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json index 489789116..b303818b1 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -413,7 +413,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -532,7 +532,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1078,7 +1078,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1117,7 +1117,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1156,7 +1156,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1195,7 +1195,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1234,7 +1234,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1273,7 +1273,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1312,7 +1312,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1351,7 +1351,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1390,7 +1390,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg index c229cf631..9e6ceb66d 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2447" height="2536" viewBox="-88 -88 2447 2536">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json index 95bd3ecee..4c8d9cd09 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -211,7 +211,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg index 516abbea1..f27e77a00 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json index 95bd3ecee..4c8d9cd09 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -211,7 +211,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg index 516abbea1..f27e77a00 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json index 61a83ea65..1ceb33052 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg index 514a06e0b..14dc4497b 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json index 61a83ea65..1ceb33052 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg index 514a06e0b..14dc4497b 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json index 00c75c1a9..af401f123 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -330,7 +330,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg index 9a2b4dca8..a38b8914f 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json index 00c75c1a9..af401f123 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -330,7 +330,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg index 9a2b4dca8..a38b8914f 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json index a87c5874a..fb7550f69 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -810,7 +810,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1479,7 +1479,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1950,7 +1950,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2028,7 +2028,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2145,7 +2145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2301,7 +2301,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4161,7 +4161,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4200,7 +4200,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4239,7 +4239,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4278,7 +4278,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4317,7 +4317,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4356,7 +4356,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4395,7 +4395,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4434,7 +4434,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4473,7 +4473,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4512,7 +4512,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4551,7 +4551,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4590,7 +4590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4629,7 +4629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4668,7 +4668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4707,7 +4707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4746,7 +4746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4785,7 +4785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4824,7 +4824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg index fab9122c5..cc85ee061 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3402" height="4269" viewBox="-100 -100 3402 4269">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json index 93a2f4d96..3ed298e02 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -810,7 +810,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1479,7 +1479,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1950,7 +1950,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2028,7 +2028,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2145,7 +2145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2301,7 +2301,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4080,7 +4080,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4119,7 +4119,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4158,7 +4158,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4197,7 +4197,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4236,7 +4236,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4275,7 +4275,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4314,7 +4314,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4353,7 +4353,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4392,7 +4392,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4431,7 +4431,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4470,7 +4470,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4509,7 +4509,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4548,7 +4548,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4587,7 +4587,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4626,7 +4626,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4665,7 +4665,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4704,7 +4704,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4743,7 +4743,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg index b5128161a..ac2e03f6c 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="3324" height="4389" viewBox="-88 -88 3324 4389">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/square_3d/dagre/board.exp.json b/e2etests/testdata/stable/square_3d/dagre/board.exp.json index ae0b398cd..8a037500b 100644 --- a/e2etests/testdata/stable/square_3d/dagre/board.exp.json +++ b/e2etests/testdata/stable/square_3d/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": true, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": true, diff --git a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg index 8070f9471..834d15ac7 100644 --- a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg @@ -20,9 +20,9 @@ width="371" height="580" viewBox="-100 -100 371 580"> -rectangle +rectangle -square -rectangle +rectangle -square acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc AKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDcontainerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json index aec76c448..35b0e5dd0 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json +++ b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg index e2c86e47a..df3ac9c7a 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="536" height="663" viewBox="-88 -88 536 663">containerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json index c36a465ab..f3951de5d 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg index 5dda9ae06..bf4b4f2b7 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="664" height="716" viewBox="-100 -100 664 716">ninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneighteightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json index dae1aff5b..d012e76be 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg index f42b3ddce..c417a43f7 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="789" height="2014" viewBox="-39 -88 789 2014">eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json index 8e5611289..bf9dc2e70 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -563,7 +563,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -602,7 +602,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -641,7 +641,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg index e9cb1975f..45f3f9430 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="921" height="1242" viewBox="-147 -26 921 1242">bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel