From edb6b857b35426baeac64a7e0bd0cac3b6ca4a31 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?J=C3=BAlio=20C=C3=A9sar=20Batista?= Date: Mon, 5 Dec 2022 10:19:26 -0800 Subject: [PATCH 01/29] Space actor centers --- d2layouts/d2sequence/sequence_diagram.go | 10 +++++----- 1 file changed, 5 insertions(+), 5 deletions(-) diff --git a/d2layouts/d2sequence/sequence_diagram.go b/d2layouts/d2sequence/sequence_diagram.go index 3df170756..752299adc 100644 --- a/d2layouts/d2sequence/sequence_diagram.go +++ b/d2layouts/d2sequence/sequence_diagram.go @@ -196,7 +196,6 @@ func newSequenceDiagram(objects []*d2graph.Object, messages []*d2graph.Edge) *se // rankDiff = 0 for self edges distributedLabelWidth := float64(message.LabelDimensions.Width) / rankDiff sd.actorXStep = math.Max(sd.actorXStep, distributedLabelWidth+HORIZONTAL_PAD) - } sd.lastMessage[message.Src] = message if _, exists := sd.firstMessage[message.Src]; !exists { @@ -287,9 +286,9 @@ func (sd *sequenceDiagram) placeGroup(group *d2graph.Object) { ) } -// placeActors places actors bottom aligned, side by side +// placeActors places actors bottom aligned, side by side with centers spaced by sd.actorXStep func (sd *sequenceDiagram) placeActors() { - x := 0. + centerX := sd.actors[0].Width / 2. for _, actor := range sd.actors { shape := actor.Attributes.Shape.Value var yOffset float64 @@ -303,8 +302,9 @@ func (sd *sequenceDiagram) placeActors() { actor.LabelPosition = go2.Pointer(string(label.InsideMiddleCenter)) yOffset = sd.maxActorHeight - actor.Height } - actor.TopLeft = geo.NewPoint(x, yOffset) - x += actor.Width + sd.actorXStep + halfWidth := actor.Width / 2. + actor.TopLeft = geo.NewPoint(math.Round(centerX-halfWidth), yOffset) + centerX += sd.actorXStep } } From 04ba174fe56e0933e1add3498a4cf1b7b3258980 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?J=C3=BAlio=20C=C3=A9sar=20Batista?= Date: Mon, 5 Dec 2022 10:27:55 -0800 Subject: [PATCH 02/29] Handle different actor distances --- d2layouts/d2sequence/sequence_diagram.go | 21 ++++++++++++++++----- 1 file changed, 16 insertions(+), 5 deletions(-) diff --git a/d2layouts/d2sequence/sequence_diagram.go b/d2layouts/d2sequence/sequence_diagram.go index 752299adc..11df81b59 100644 --- a/d2layouts/d2sequence/sequence_diagram.go +++ b/d2layouts/d2sequence/sequence_diagram.go @@ -32,8 +32,11 @@ type sequenceDiagram struct { firstMessage map[*d2graph.Object]*d2graph.Edge lastMessage map[*d2graph.Object]*d2graph.Edge + // the distance from actor[i] center to actor[i+1] center + // every neighbor actors need different distances depending on the message labels between them + actorXStep []float64 + yStep float64 - actorXStep float64 maxActorHeight float64 verticalIndices map[string]int @@ -139,8 +142,8 @@ func newSequenceDiagram(objects []*d2graph.Object, messages []*d2graph.Edge) *se objectRank: make(map[*d2graph.Object]int), firstMessage: make(map[*d2graph.Object]*d2graph.Edge), lastMessage: make(map[*d2graph.Object]*d2graph.Edge), + actorXStep: make([]float64, len(actors)-1), yStep: MIN_MESSAGE_DISTANCE, - actorXStep: MIN_ACTOR_DISTANCE, maxActorHeight: 0., verticalIndices: make(map[string]int), } @@ -183,6 +186,10 @@ func newSequenceDiagram(objects []*d2graph.Object, messages []*d2graph.Edge) *se queue = append(queue, child.ChildrenArray...) } + + if rank != len(actors)-1 { + sd.actorXStep[rank] = math.Max(actor.Width/2., MIN_ACTOR_DISTANCE) + } } for _, message := range sd.messages { @@ -195,7 +202,9 @@ func newSequenceDiagram(objects []*d2graph.Object, messages []*d2graph.Edge) *se if rankDiff != 0 { // rankDiff = 0 for self edges distributedLabelWidth := float64(message.LabelDimensions.Width) / rankDiff - sd.actorXStep = math.Max(sd.actorXStep, distributedLabelWidth+HORIZONTAL_PAD) + for rank := sd.objectRank[message.Src]; rank <= sd.objectRank[message.Dst]-1; rank++ { + sd.actorXStep[rank] = math.Max(sd.actorXStep[rank], distributedLabelWidth+HORIZONTAL_PAD) + } } sd.lastMessage[message.Src] = message if _, exists := sd.firstMessage[message.Src]; !exists { @@ -289,7 +298,7 @@ func (sd *sequenceDiagram) placeGroup(group *d2graph.Object) { // placeActors places actors bottom aligned, side by side with centers spaced by sd.actorXStep func (sd *sequenceDiagram) placeActors() { centerX := sd.actors[0].Width / 2. - for _, actor := range sd.actors { + for rank, actor := range sd.actors { shape := actor.Attributes.Shape.Value var yOffset float64 if shape == d2target.ShapeImage || shape == d2target.ShapePerson { @@ -304,7 +313,9 @@ func (sd *sequenceDiagram) placeActors() { } halfWidth := actor.Width / 2. actor.TopLeft = geo.NewPoint(math.Round(centerX-halfWidth), yOffset) - centerX += sd.actorXStep + if rank != len(sd.actors)-1 { + centerX += sd.actorXStep[rank] + } } } From 3eca7bd13923395ba8bd4f691e40286b9ccdb1aa Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?J=C3=BAlio=20C=C3=A9sar=20Batista?= Date: Mon, 5 Dec 2022 10:33:46 -0800 Subject: [PATCH 03/29] Update tests --- d2layouts/d2sequence/layout_test.go | 8 +- e2etests/stable_test.go | 12 + .../dagre/board.exp.json | 553 ++++++++++++++++++ .../dagre/sketch.exp.svg | 39 ++ .../elk/board.exp.json | 553 ++++++++++++++++++ .../elk/sketch.exp.svg | 39 ++ .../dagre/board.exp.json | 188 +++--- .../dagre/sketch.exp.svg | 28 +- .../elk/board.exp.json | 188 +++--- .../elk/sketch.exp.svg | 28 +- .../dagre/board.exp.json | 80 +-- .../dagre/sketch.exp.svg | 14 +- .../elk/board.exp.json | 80 +-- .../elk/sketch.exp.svg | 14 +- .../dagre/board.exp.json | 90 +-- .../dagre/sketch.exp.svg | 4 +- .../elk/board.exp.json | 90 +-- .../elk/sketch.exp.svg | 4 +- .../dagre/board.exp.json | 32 +- .../dagre/sketch.exp.svg | 8 +- .../sequence_diagram_note/elk/board.exp.json | 32 +- .../sequence_diagram_note/elk/sketch.exp.svg | 8 +- .../dagre/board.exp.json | 92 +-- .../dagre/sketch.exp.svg | 32 +- .../sequence_diagram_real/elk/board.exp.json | 92 +-- .../sequence_diagram_real/elk/sketch.exp.svg | 32 +- .../dagre/board.exp.json | 42 +- .../dagre/sketch.exp.svg | 16 +- .../elk/board.exp.json | 42 +- .../elk/sketch.exp.svg | 16 +- .../dagre/board.exp.json | 56 +- .../dagre/sketch.exp.svg | 22 +- .../elk/board.exp.json | 56 +- .../elk/sketch.exp.svg | 22 +- .../dagre/board.exp.json | 80 +-- .../dagre/sketch.exp.svg | 30 +- .../sequence_diagram_span/elk/board.exp.json | 80 +-- .../sequence_diagram_span/elk/sketch.exp.svg | 30 +- .../sequence_diagrams/dagre/board.exp.json | 390 ++++++------ .../sequence_diagrams/dagre/sketch.exp.svg | 54 +- .../sequence_diagrams/elk/board.exp.json | 346 +++++------ .../sequence_diagrams/elk/sketch.exp.svg | 54 +- 42 files changed, 2436 insertions(+), 1240 deletions(-) create mode 100644 e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/board.exp.json create mode 100644 e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/sketch.exp.svg create mode 100644 e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json create mode 100644 e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg diff --git a/d2layouts/d2sequence/layout_test.go b/d2layouts/d2sequence/layout_test.go index 5f2368c9b..dc4e6d07c 100644 --- a/d2layouts/d2sequence/layout_test.go +++ b/d2layouts/d2sequence/layout_test.go @@ -393,7 +393,7 @@ func TestSelfEdges(t *testing.T) { } ctx := log.WithTB(context.Background(), t, nil) - Layout(ctx, g, func(ctx context.Context, g *d2graph.Graph) error { + d2sequence.Layout(ctx, g, func(ctx context.Context, g *d2graph.Graph) error { return nil }) @@ -406,8 +406,8 @@ func TestSelfEdges(t *testing.T) { t.Fatalf("route does not end at the same actor, start at %.5f, end at %.5f", route[0].X, route[3].X) } - if route[3].Y-route[0].Y != MIN_MESSAGE_DISTANCE { - t.Fatalf("expected route height to be %.f5, got %.5f", MIN_MESSAGE_DISTANCE, route[3].Y-route[0].Y) + if route[3].Y-route[0].Y != d2sequence.MIN_MESSAGE_DISTANCE { + t.Fatalf("expected route height to be %.f5, got %.5f", d2sequence.MIN_MESSAGE_DISTANCE, route[3].Y-route[0].Y) } } @@ -435,7 +435,7 @@ func TestSequenceToDescendant(t *testing.T) { } ctx := log.WithTB(context.Background(), t, nil) - Layout(ctx, g, func(ctx context.Context, g *d2graph.Graph) error { + d2sequence.Layout(ctx, g, func(ctx context.Context, g *d2graph.Graph) error { return nil }) diff --git a/e2etests/stable_test.go b/e2etests/stable_test.go index d256a29ed..526d22aca 100644 --- a/e2etests/stable_test.go +++ b/e2etests/stable_test.go @@ -1408,6 +1408,18 @@ choo: { d2exporter.export -> CLI: resulting SVG } `, + }, { + name: "sequence_diagram_actor_distance", + script: `shape: sequence_diagram +a: "an actor with a really long label that will break everything" +b: "a short one" +c: "an\nactor\nwith\na\nreally\nlong\nlabel\nthat\nwill\nbreak\neverything" +d: "simple" +a -> b -> c: "short" +a -> b: "long label for testing purposes and it must be really, really long" +b -> c: "long label for testing purposes and it must be really, really long" +c -> d: "short" +a -> d: "this should span many actors lifelines so we know how it will look like when redering a long label over many actors"`, }, } diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/board.exp.json new file mode 100644 index 000000000..6a65d1acc --- /dev/null +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/board.exp.json @@ -0,0 +1,553 @@ +{ + "name": "", + "shapes": [ + { + "id": "a", + "type": "", + "pos": { + "x": 0, + "y": 210 + }, + "width": 514, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#F7F8FE", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "an actor with a really long label that will break everything", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": true, + "underline": false, + "labelWidth": 414, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + }, + { + "id": "b", + "type": "", + "pos": { + "x": 626, + "y": 210 + }, + "width": 184, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#F7F8FE", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "a short one", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": true, + "underline": false, + "labelWidth": 84, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + }, + { + "id": "c", + "type": "", + "pos": { + "x": 1088, + "y": 50 + }, + "width": 183, + "height": 286, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#F7F8FE", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "an\nactor\nwith\na\nreally\nlong\nlabel\nthat\nwill\nbreak\neverything", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": true, + "underline": false, + "labelWidth": 83, + "labelHeight": 186, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + }, + { + "id": "d", + "type": "", + "pos": { + "x": 1401, + "y": 210 + }, + "width": 152, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#F7F8FE", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "simple", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": true, + "underline": false, + "labelWidth": 52, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + } + ], + "connections": [ + { + "id": "(a -> b)[0]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "short", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 36, + "labelHeight": 21, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "labelPercentage": 0, + "route": [ + { + "x": 257, + "y": 466 + }, + { + "x": 718, + "y": 466 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 2 + }, + { + "id": "(b -> c)[0]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "c", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "short", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 36, + "labelHeight": 21, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "labelPercentage": 0, + "route": [ + { + "x": 718, + "y": 596 + }, + { + "x": 1179.5, + "y": 596 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 2 + }, + { + "id": "(a -> b)[1]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "long label for testing purposes and it must be really, really long", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 411, + "labelHeight": 21, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "labelPercentage": 0, + "route": [ + { + "x": 257, + "y": 726 + }, + { + "x": 718, + "y": 726 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 2 + }, + { + "id": "(b -> c)[1]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "c", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "long label for testing purposes and it must be really, really long", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 411, + "labelHeight": 21, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "labelPercentage": 0, + "route": [ + { + "x": 718, + "y": 856 + }, + { + "x": 1179.5, + "y": 856 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 2 + }, + { + "id": "(c -> d)[0]", + "src": "c", + "srcArrow": "none", + "srcLabel": "", + "dst": "d", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "short", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 36, + "labelHeight": 21, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "labelPercentage": 0, + "route": [ + { + "x": 1179.5, + "y": 986 + }, + { + "x": 1477, + "y": 986 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 2 + }, + { + "id": "(a -> d)[0]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "d", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "this should span many actors lifelines so we know how it will look like when redering a long label over many actors", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 745, + "labelHeight": 21, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "labelPercentage": 0, + "route": [ + { + "x": 257, + "y": 1116 + }, + { + "x": 1477, + "y": 1116 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 2 + }, + { + "id": "(a -- )[0]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "a-lifeline-end-2251863791", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 257, + "y": 336 + }, + { + "x": 257, + "y": 1246 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 0 + }, + { + "id": "(b -- )[0]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "b-lifeline-end-668380428", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 718, + "y": 336 + }, + { + "x": 718, + "y": 1246 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 0 + }, + { + "id": "(c -- )[0]", + "src": "c", + "srcArrow": "none", + "srcLabel": "", + "dst": "c-lifeline-end-955173837", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 1179.5, + "y": 336 + }, + { + "x": 1179.5, + "y": 1246 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 0 + }, + { + "id": "(d -- )[0]", + "src": "d", + "srcArrow": "none", + "srcLabel": "", + "dst": "d-lifeline-end-2106864010", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 1477, + "y": 336 + }, + { + "x": 1477, + "y": 1246 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 0 + } + ] +} diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/sketch.exp.svg new file mode 100644 index 000000000..ab5408c09 --- /dev/null +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/dagre/sketch.exp.svg @@ -0,0 +1,39 @@ + +an actor with a really long label that will break everythinga short oneanactorwithareallylonglabelthatwillbreakeverythingsimple shortshortlong label for testing purposes and it must be really, really longlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actors + + + + + + + + \ No newline at end of file diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json new file mode 100644 index 000000000..6a65d1acc --- /dev/null +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json @@ -0,0 +1,553 @@ +{ + "name": "", + "shapes": [ + { + "id": "a", + "type": "", + "pos": { + "x": 0, + "y": 210 + }, + "width": 514, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#F7F8FE", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "an actor with a really long label that will break everything", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": true, + "underline": false, + "labelWidth": 414, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + }, + { + "id": "b", + "type": "", + "pos": { + "x": 626, + "y": 210 + }, + "width": 184, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#F7F8FE", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "a short one", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": true, + "underline": false, + "labelWidth": 84, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + }, + { + "id": "c", + "type": "", + "pos": { + "x": 1088, + "y": 50 + }, + "width": 183, + "height": 286, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#F7F8FE", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "an\nactor\nwith\na\nreally\nlong\nlabel\nthat\nwill\nbreak\neverything", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": true, + "underline": false, + "labelWidth": 83, + "labelHeight": 186, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + }, + { + "id": "d", + "type": "", + "pos": { + "x": 1401, + "y": 210 + }, + "width": 152, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#F7F8FE", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "simple", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": true, + "underline": false, + "labelWidth": 52, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + } + ], + "connections": [ + { + "id": "(a -> b)[0]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "short", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 36, + "labelHeight": 21, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "labelPercentage": 0, + "route": [ + { + "x": 257, + "y": 466 + }, + { + "x": 718, + "y": 466 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 2 + }, + { + "id": "(b -> c)[0]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "c", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "short", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 36, + "labelHeight": 21, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "labelPercentage": 0, + "route": [ + { + "x": 718, + "y": 596 + }, + { + "x": 1179.5, + "y": 596 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 2 + }, + { + "id": "(a -> b)[1]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "long label for testing purposes and it must be really, really long", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 411, + "labelHeight": 21, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "labelPercentage": 0, + "route": [ + { + "x": 257, + "y": 726 + }, + { + "x": 718, + "y": 726 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 2 + }, + { + "id": "(b -> c)[1]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "c", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "long label for testing purposes and it must be really, really long", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 411, + "labelHeight": 21, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "labelPercentage": 0, + "route": [ + { + "x": 718, + "y": 856 + }, + { + "x": 1179.5, + "y": 856 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 2 + }, + { + "id": "(c -> d)[0]", + "src": "c", + "srcArrow": "none", + "srcLabel": "", + "dst": "d", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "short", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 36, + "labelHeight": 21, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "labelPercentage": 0, + "route": [ + { + "x": 1179.5, + "y": 986 + }, + { + "x": 1477, + "y": 986 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 2 + }, + { + "id": "(a -> d)[0]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "d", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "this should span many actors lifelines so we know how it will look like when redering a long label over many actors", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 745, + "labelHeight": 21, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "labelPercentage": 0, + "route": [ + { + "x": 257, + "y": 1116 + }, + { + "x": 1477, + "y": 1116 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 2 + }, + { + "id": "(a -- )[0]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "a-lifeline-end-2251863791", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 257, + "y": 336 + }, + { + "x": 257, + "y": 1246 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 0 + }, + { + "id": "(b -- )[0]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "b-lifeline-end-668380428", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 718, + "y": 336 + }, + { + "x": 718, + "y": 1246 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 0 + }, + { + "id": "(c -- )[0]", + "src": "c", + "srcArrow": "none", + "srcLabel": "", + "dst": "c-lifeline-end-955173837", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 1179.5, + "y": 336 + }, + { + "x": 1179.5, + "y": 1246 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 0 + }, + { + "id": "(d -- )[0]", + "src": "d", + "srcArrow": "none", + "srcLabel": "", + "dst": "d-lifeline-end-2106864010", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 1477, + "y": 336 + }, + { + "x": 1477, + "y": 1246 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 0 + } + ] +} diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg new file mode 100644 index 000000000..ab5408c09 --- /dev/null +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg @@ -0,0 +1,39 @@ + +an actor with a really long label that will break everythinga short oneanactorwithareallylonglabelthatwillbreakeverythingsimple shortshortlong label for testing purposes and it must be really, really longlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actors + + + + + + + + \ No newline at end of file diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json index 49097965c..4c42ba6d9 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json @@ -44,7 +44,7 @@ "id": "b", "type": "oval", "pos": { - "x": 410, + "x": 259, "y": 84 }, "width": 150, @@ -83,7 +83,7 @@ "id": "c", "type": "class", "pos": { - "x": 817, + "x": 463, "y": 50 }, "width": 241, @@ -133,7 +133,7 @@ "id": "d", "type": "cloud", "pos": { - "x": 1315, + "x": 744, "y": 108 }, "width": 179, @@ -172,7 +172,7 @@ "id": "e", "type": "code", "pos": { - "x": 1751, + "x": 986, "y": 164 }, "width": 196, @@ -211,7 +211,7 @@ "id": "f", "type": "cylinder", "pos": { - "x": 2204, + "x": 1259, "y": 84 }, "width": 150, @@ -250,7 +250,7 @@ "id": "g", "type": "diamond", "pos": { - "x": 2611, + "x": 1509, "y": 85 }, "width": 150, @@ -289,7 +289,7 @@ "id": "h", "type": "document", "pos": { - "x": 3018, + "x": 1759, "y": 97 }, "width": 150, @@ -328,7 +328,7 @@ "id": "i", "type": "hexagon", "pos": { - "x": 3425, + "x": 1993, "y": 108 }, "width": 182, @@ -367,7 +367,7 @@ "id": "j", "type": "image", "pos": { - "x": 3864, + "x": 2259, "y": 63 }, "width": 150, @@ -417,7 +417,7 @@ "id": "k", "type": "oval", "pos": { - "x": 4271, + "x": 2509, "y": 97 }, "width": 150, @@ -456,7 +456,7 @@ "id": "l", "type": "package", "pos": { - "x": 4678, + "x": 2759, "y": 98 }, "width": 150, @@ -495,7 +495,7 @@ "id": "m", "type": "page", "pos": { - "x": 5085, + "x": 2996, "y": 108 }, "width": 175, @@ -534,7 +534,7 @@ "id": "n", "type": "parallelogram", "pos": { - "x": 5517, + "x": 3242, "y": 92 }, "width": 183, @@ -573,7 +573,7 @@ "id": "o", "type": "person", "pos": { - "x": 5957, + "x": 3507, "y": 55 }, "width": 154, @@ -612,7 +612,7 @@ "id": "p", "type": "queue", "pos": { - "x": 6368, + "x": 3753, "y": 108 }, "width": 161, @@ -651,7 +651,7 @@ "id": "q", "type": "rectangle", "pos": { - "x": 6786, + "x": 4001, "y": 69 }, "width": 165, @@ -690,7 +690,7 @@ "id": "r", "type": "step", "pos": { - "x": 7208, + "x": 4227, "y": 108 }, "width": 213, @@ -729,7 +729,7 @@ "id": "s", "type": "stored_data", "pos": { - "x": 7678, + "x": 4509, "y": 96 }, "width": 150, @@ -768,7 +768,7 @@ "id": "t", "type": "sql_table", "pos": { - "x": 8085, + "x": 4729, "y": 126 }, "width": 210, @@ -848,7 +848,7 @@ "y": 364 }, { - "x": 485, + "x": 334, "y": 364 } ], @@ -883,11 +883,11 @@ "labelPercentage": 0, "route": [ { - "x": 485, + "x": 334, "y": 494 }, { - "x": 937.5, + "x": 583.5, "y": 494 } ], @@ -922,11 +922,11 @@ "labelPercentage": 0, "route": [ { - "x": 937.5, + "x": 583.5, "y": 624 }, { - "x": 1404.5, + "x": 833.5, "y": 624 } ], @@ -961,11 +961,11 @@ "labelPercentage": 0, "route": [ { - "x": 1404.5, + "x": 833.5, "y": 754 }, { - "x": 1849, + "x": 1084, "y": 754 } ], @@ -1000,11 +1000,11 @@ "labelPercentage": 0, "route": [ { - "x": 1849, + "x": 1084, "y": 884 }, { - "x": 2279, + "x": 1334, "y": 884 } ], @@ -1039,11 +1039,11 @@ "labelPercentage": 0, "route": [ { - "x": 2279, + "x": 1334, "y": 1014 }, { - "x": 2686, + "x": 1584, "y": 1014 } ], @@ -1078,11 +1078,11 @@ "labelPercentage": 0, "route": [ { - "x": 2686, + "x": 1584, "y": 1144 }, { - "x": 3093, + "x": 1834, "y": 1144 } ], @@ -1117,11 +1117,11 @@ "labelPercentage": 0, "route": [ { - "x": 3093, + "x": 1834, "y": 1274 }, { - "x": 3516, + "x": 2084, "y": 1274 } ], @@ -1156,11 +1156,11 @@ "labelPercentage": 0, "route": [ { - "x": 3516, + "x": 2084, "y": 1404 }, { - "x": 3939, + "x": 2334, "y": 1404 } ], @@ -1195,11 +1195,11 @@ "labelPercentage": 0, "route": [ { - "x": 3939, + "x": 2334, "y": 1534 }, { - "x": 4346, + "x": 2584, "y": 1534 } ], @@ -1234,11 +1234,11 @@ "labelPercentage": 0, "route": [ { - "x": 4346, + "x": 2584, "y": 1664 }, { - "x": 4753, + "x": 2834, "y": 1664 } ], @@ -1273,11 +1273,11 @@ "labelPercentage": 0, "route": [ { - "x": 4753, + "x": 2834, "y": 1794 }, { - "x": 5172.5, + "x": 3083.5, "y": 1794 } ], @@ -1312,11 +1312,11 @@ "labelPercentage": 0, "route": [ { - "x": 5172.5, + "x": 3083.5, "y": 1924 }, { - "x": 5608.5, + "x": 3333.5, "y": 1924 } ], @@ -1351,11 +1351,11 @@ "labelPercentage": 0, "route": [ { - "x": 5608.5, + "x": 3333.5, "y": 2054 }, { - "x": 6034, + "x": 3584, "y": 2054 } ], @@ -1390,11 +1390,11 @@ "labelPercentage": 0, "route": [ { - "x": 6034, + "x": 3584, "y": 2184 }, { - "x": 6448.5, + "x": 3833.5, "y": 2184 } ], @@ -1429,11 +1429,11 @@ "labelPercentage": 0, "route": [ { - "x": 6448.5, + "x": 3833.5, "y": 2314 }, { - "x": 6868.5, + "x": 4083.5, "y": 2314 } ], @@ -1468,11 +1468,11 @@ "labelPercentage": 0, "route": [ { - "x": 6868.5, + "x": 4083.5, "y": 2444 }, { - "x": 7314.5, + "x": 4333.5, "y": 2444 } ], @@ -1507,11 +1507,11 @@ "labelPercentage": 0, "route": [ { - "x": 7314.5, + "x": 4333.5, "y": 2574 }, { - "x": 7753, + "x": 4584, "y": 2574 } ], @@ -1546,11 +1546,11 @@ "labelPercentage": 0, "route": [ { - "x": 7753, + "x": 4584, "y": 2704 }, { - "x": 8190, + "x": 4834, "y": 2704 } ], @@ -1624,11 +1624,11 @@ "labelPercentage": 0, "route": [ { - "x": 485, + "x": 334, "y": 234 }, { - "x": 485, + "x": 334, "y": 2834 } ], @@ -1663,11 +1663,11 @@ "labelPercentage": 0, "route": [ { - "x": 937.5, + "x": 583.5, "y": 234 }, { - "x": 937.5, + "x": 583.5, "y": 2834 } ], @@ -1702,11 +1702,11 @@ "labelPercentage": 0, "route": [ { - "x": 1404.5, + "x": 833.5, "y": 234 }, { - "x": 1404.5, + "x": 833.5, "y": 2834 } ], @@ -1741,11 +1741,11 @@ "labelPercentage": 0, "route": [ { - "x": 1849, + "x": 1084, "y": 234 }, { - "x": 1849, + "x": 1084, "y": 2834 } ], @@ -1780,11 +1780,11 @@ "labelPercentage": 0, "route": [ { - "x": 2279, + "x": 1334, "y": 234 }, { - "x": 2279, + "x": 1334, "y": 2834 } ], @@ -1819,11 +1819,11 @@ "labelPercentage": 0, "route": [ { - "x": 2686, + "x": 1584, "y": 234 }, { - "x": 2686, + "x": 1584, "y": 2834 } ], @@ -1858,11 +1858,11 @@ "labelPercentage": 0, "route": [ { - "x": 3093, + "x": 1834, "y": 234 }, { - "x": 3093, + "x": 1834, "y": 2834 } ], @@ -1897,11 +1897,11 @@ "labelPercentage": 0, "route": [ { - "x": 3516, + "x": 2084, "y": 234 }, { - "x": 3516, + "x": 2084, "y": 2834 } ], @@ -1936,11 +1936,11 @@ "labelPercentage": 0, "route": [ { - "x": 3939, + "x": 2334, "y": 239 }, { - "x": 3939, + "x": 2334, "y": 2834 } ], @@ -1975,11 +1975,11 @@ "labelPercentage": 0, "route": [ { - "x": 4346, + "x": 2584, "y": 234 }, { - "x": 4346, + "x": 2584, "y": 2834 } ], @@ -2014,11 +2014,11 @@ "labelPercentage": 0, "route": [ { - "x": 4753, + "x": 2834, "y": 234 }, { - "x": 4753, + "x": 2834, "y": 2834 } ], @@ -2053,11 +2053,11 @@ "labelPercentage": 0, "route": [ { - "x": 5172.5, + "x": 3083.5, "y": 234 }, { - "x": 5172.5, + "x": 3083.5, "y": 2834 } ], @@ -2092,11 +2092,11 @@ "labelPercentage": 0, "route": [ { - "x": 5608.5, + "x": 3333.5, "y": 234 }, { - "x": 5608.5, + "x": 3333.5, "y": 2834 } ], @@ -2131,11 +2131,11 @@ "labelPercentage": 0, "route": [ { - "x": 6034, + "x": 3584, "y": 239 }, { - "x": 6034, + "x": 3584, "y": 2834 } ], @@ -2170,11 +2170,11 @@ "labelPercentage": 0, "route": [ { - "x": 6448.5, + "x": 3833.5, "y": 234 }, { - "x": 6448.5, + "x": 3833.5, "y": 2834 } ], @@ -2209,11 +2209,11 @@ "labelPercentage": 0, "route": [ { - "x": 6868.5, + "x": 4083.5, "y": 234 }, { - "x": 6868.5, + "x": 4083.5, "y": 2834 } ], @@ -2248,11 +2248,11 @@ "labelPercentage": 0, "route": [ { - "x": 7314.5, + "x": 4333.5, "y": 234 }, { - "x": 7314.5, + "x": 4333.5, "y": 2834 } ], @@ -2287,11 +2287,11 @@ "labelPercentage": 0, "route": [ { - "x": 7753, + "x": 4584, "y": 234 }, { - "x": 7753, + "x": 4584, "y": 2834 } ], @@ -2326,11 +2326,11 @@ "labelPercentage": 0, "route": [ { - "x": 8190, + "x": 4834, "y": 234 }, { - "x": 8190, + "x": 4834, "y": 2834 } ], diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg index 0428bcef4..2d74a90f0 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg @@ -2,7 +2,7 @@ a labelblabelsa class+ +public() bool +void- +private() int +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid -int -name -varchar - result := callThisFunction(obj, 5) midthis sideother side - - - +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +int +name +varchar + result := callThisFunction(obj, 5) midthis sideother side + + + a labelblabelsa class+ -public() bool -void- -private() int -voidcloudyyyya := 5 +a labelblabelsa class+ +public() bool +void- +private() int +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid -int -name -varchar - result := callThisFunction(obj, 5) midthis sideother side - - - +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +int +name +varchar + result := callThisFunction(obj, 5) midthis sideother side + + + abcdggggroup 1group bchoonested guywhat would arnold saythis note lalaeyokayokay - - - - - +abcdggggroup 1group bchoonested guywhat would arnold saythis note lalaeyokayokay + + + + + abcdggggroup 1group bchoonested guywhat would arnold saythis note lalaeyokayokay - - - - - +abcdggggroup 1group bchoonested guywhat would arnold saythis note lalaeyokayokay + + + + + scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome abcdexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier okay - - +abcdexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier okay + + abcdexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier okay - - +abcdexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier okay + + How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutmeasurements also take place 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVG - - - - - - - - - - - - - - +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutmeasurements also take place 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVG + + + + + + + + + + + + + + How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutmeasurements also take place 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVG - - - - - - - - - - - - - - +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutmeasurements also take place 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVG + + + + + + + + + + + + + + ab a self edge herebetween actorsto descendantto deeper descendantto parentactor - +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor + - - - - - + + + + + ab a self edge herebetween actorsto descendantto deeper descendantto parentactor - +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor + - - - - - + + + + + AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response - - - - - - - - - +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response + + + + + + + + + AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response - - - - - - - - - +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response + + + + + + + + + scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - - - - - - - - - - - - - +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + + + + + + + + + + + + + a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - - - - - - - - - - - - - +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + + + + + + + + + + + + + an actor with a really long label that will break everythinga short oneanactorwithareallylonglabelthatwillbreakeverythingsimple shortshortlong label for testing purposes and it must be really, really longlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actors +an actor with a really long label that will break everythinga short oneanactorwithareallylonglabelthatwillbreakeverythingsimple shortshortlong label for testing purposes and it must be really, really longlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actors diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json index 6a65d1acc..bfd562063 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -53,7 +53,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -92,7 +92,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -131,7 +131,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -196,7 +196,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 4 }, { "id": "(b -> c)[0]", @@ -235,7 +235,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 4 }, { "id": "(a -> b)[1]", @@ -274,7 +274,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 4 }, { "id": "(b -> c)[1]", @@ -313,7 +313,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 4 }, { "id": "(c -> d)[0]", @@ -352,7 +352,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 4 }, { "id": "(a -> d)[0]", @@ -391,7 +391,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 4 }, { "id": "(a -- )[0]", @@ -430,7 +430,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 0 + "zIndex": 2 }, { "id": "(b -- )[0]", @@ -469,7 +469,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 0 + "zIndex": 2 }, { "id": "(c -- )[0]", @@ -508,7 +508,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 0 + "zIndex": 2 }, { "id": "(d -- )[0]", @@ -547,7 +547,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 0 + "zIndex": 2 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg index ab5408c09..d1f73d658 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg @@ -14,7 +14,7 @@ width="1753" height="1396" viewBox="-100 -50 1753 1396">an actor with a really long label that will break everythinga short oneanactorwithareallylonglabelthatwillbreakeverythingsimple shortshortlong label for testing purposes and it must be really, really longlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actors +an actor with a really long label that will break everythinga short oneanactorwithareallylonglabelthatwillbreakeverythingsimple shortshortlong label for testing purposes and it must be really, really longlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actors diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json index 73b2fad99..b6504c0b0 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json @@ -44,7 +44,7 @@ "id": "b", "type": "oval", "pos": { - "x": 223, + "x": 259, "y": 87 }, "width": 150, @@ -83,7 +83,7 @@ "id": "c", "type": "class", "pos": { - "x": 443, + "x": 289, "y": 50 }, "width": 241, @@ -133,7 +133,7 @@ "id": "d", "type": "cloud", "pos": { - "x": 754, + "x": 441, "y": 108 }, "width": 179, @@ -172,7 +172,7 @@ "id": "e", "type": "code", "pos": { - "x": 1003, + "x": 522, "y": 164 }, "width": 196, @@ -211,7 +211,7 @@ "id": "f", "type": "cylinder", "pos": { - "x": 1269, + "x": 643, "y": 108 }, "width": 150, @@ -250,7 +250,7 @@ "id": "g", "type": "diamond", "pos": { - "x": 1489, + "x": 718, "y": 108 }, "width": 150, @@ -289,7 +289,7 @@ "id": "h", "type": "document", "pos": { - "x": 1709, + "x": 793, "y": 108 }, "width": 150, @@ -328,7 +328,7 @@ "id": "i", "type": "hexagon", "pos": { - "x": 1929, + "x": 852, "y": 108 }, "width": 182, @@ -367,7 +367,7 @@ "id": "j", "type": "image", "pos": { - "x": 2181, + "x": 959, "y": 85 }, "width": 150, @@ -417,7 +417,7 @@ "id": "k", "type": "oval", "pos": { - "x": 2401, + "x": 1034, "y": 108 }, "width": 150, @@ -456,7 +456,7 @@ "id": "l", "type": "package", "pos": { - "x": 2621, + "x": 1109, "y": 108 }, "width": 150, @@ -495,7 +495,7 @@ "id": "m", "type": "page", "pos": { - "x": 2841, + "x": 1171, "y": 108 }, "width": 175, @@ -534,7 +534,7 @@ "id": "n", "type": "parallelogram", "pos": { - "x": 3086, + "x": 1255, "y": 92 }, "width": 183, @@ -573,7 +573,7 @@ "id": "o", "type": "person", "pos": { - "x": 3339, + "x": 1361, "y": 55 }, "width": 154, @@ -612,7 +612,7 @@ "id": "p", "type": "queue", "pos": { - "x": 3563, + "x": 1434, "y": 108 }, "width": 161, @@ -651,7 +651,7 @@ "id": "q", "type": "rectangle", "pos": { - "x": 3794, + "x": 1513, "y": 69 }, "width": 165, @@ -690,7 +690,7 @@ "id": "r", "type": "step", "pos": { - "x": 4029, + "x": 1571, "y": 108 }, "width": 213, @@ -729,7 +729,7 @@ "id": "s", "type": "stored_data", "pos": { - "x": 4312, + "x": 1709, "y": 108 }, "width": 150, @@ -768,7 +768,7 @@ "id": "t", "type": "sql_table", "pos": { - "x": 4532, + "x": 1754, "y": 126 }, "width": 210, @@ -848,7 +848,7 @@ "y": 364 }, { - "x": 298, + "x": 334, "y": 364 } ], @@ -883,11 +883,11 @@ "labelPercentage": 0, "route": [ { - "x": 298, + "x": 334, "y": 494 }, { - "x": 563.5, + "x": 409.5, "y": 494 } ], @@ -922,11 +922,11 @@ "labelPercentage": 0, "route": [ { - "x": 563.5, + "x": 409.5, "y": 624 }, { - "x": 843.5, + "x": 530.5, "y": 624 } ], @@ -961,11 +961,11 @@ "labelPercentage": 0, "route": [ { - "x": 843.5, + "x": 530.5, "y": 754 }, { - "x": 1101, + "x": 620, "y": 754 } ], @@ -1000,11 +1000,11 @@ "labelPercentage": 0, "route": [ { - "x": 1101, + "x": 620, "y": 884 }, { - "x": 1344, + "x": 718, "y": 884 } ], @@ -1039,11 +1039,11 @@ "labelPercentage": 0, "route": [ { - "x": 1344, + "x": 718, "y": 1014 }, { - "x": 1564, + "x": 793, "y": 1014 } ], @@ -1078,11 +1078,11 @@ "labelPercentage": 0, "route": [ { - "x": 1564, + "x": 793, "y": 1144 }, { - "x": 1784, + "x": 868, "y": 1144 } ], @@ -1117,11 +1117,11 @@ "labelPercentage": 0, "route": [ { - "x": 1784, + "x": 868, "y": 1274 }, { - "x": 2020, + "x": 943, "y": 1274 } ], @@ -1156,11 +1156,11 @@ "labelPercentage": 0, "route": [ { - "x": 2020, + "x": 943, "y": 1404 }, { - "x": 2256, + "x": 1034, "y": 1404 } ], @@ -1195,11 +1195,11 @@ "labelPercentage": 0, "route": [ { - "x": 2256, + "x": 1034, "y": 1534 }, { - "x": 2476, + "x": 1109, "y": 1534 } ], @@ -1234,11 +1234,11 @@ "labelPercentage": 0, "route": [ { - "x": 2476, + "x": 1109, "y": 1664 }, { - "x": 2696, + "x": 1184, "y": 1664 } ], @@ -1273,11 +1273,11 @@ "labelPercentage": 0, "route": [ { - "x": 2696, + "x": 1184, "y": 1794 }, { - "x": 2928.5, + "x": 1258.5, "y": 1794 } ], @@ -1312,11 +1312,11 @@ "labelPercentage": 0, "route": [ { - "x": 2928.5, + "x": 1258.5, "y": 1924 }, { - "x": 3177.5, + "x": 1346.5, "y": 1924 } ], @@ -1351,11 +1351,11 @@ "labelPercentage": 0, "route": [ { - "x": 3177.5, + "x": 1346.5, "y": 2054 }, { - "x": 3416, + "x": 1438, "y": 2054 } ], @@ -1390,11 +1390,11 @@ "labelPercentage": 0, "route": [ { - "x": 3416, + "x": 1438, "y": 2184 }, { - "x": 3643.5, + "x": 1514.5, "y": 2184 } ], @@ -1429,11 +1429,11 @@ "labelPercentage": 0, "route": [ { - "x": 3643.5, + "x": 1514.5, "y": 2314 }, { - "x": 3876.5, + "x": 1595.5, "y": 2314 } ], @@ -1468,11 +1468,11 @@ "labelPercentage": 0, "route": [ { - "x": 3876.5, + "x": 1595.5, "y": 2444 }, { - "x": 4135.5, + "x": 1677.5, "y": 2444 } ], @@ -1507,11 +1507,11 @@ "labelPercentage": 0, "route": [ { - "x": 4135.5, + "x": 1677.5, "y": 2574 }, { - "x": 4387, + "x": 1784, "y": 2574 } ], @@ -1546,11 +1546,11 @@ "labelPercentage": 0, "route": [ { - "x": 4387, + "x": 1784, "y": 2704 }, { - "x": 4637, + "x": 1859, "y": 2704 } ], @@ -1624,11 +1624,11 @@ "labelPercentage": 0, "route": [ { - "x": 298, + "x": 334, "y": 234 }, { - "x": 298, + "x": 334, "y": 2834 } ], @@ -1663,11 +1663,11 @@ "labelPercentage": 0, "route": [ { - "x": 563.5, + "x": 409.5, "y": 234 }, { - "x": 563.5, + "x": 409.5, "y": 2834 } ], @@ -1702,11 +1702,11 @@ "labelPercentage": 0, "route": [ { - "x": 843.5, + "x": 530.5, "y": 234 }, { - "x": 843.5, + "x": 530.5, "y": 2834 } ], @@ -1741,11 +1741,11 @@ "labelPercentage": 0, "route": [ { - "x": 1101, + "x": 620, "y": 234 }, { - "x": 1101, + "x": 620, "y": 2834 } ], @@ -1780,11 +1780,11 @@ "labelPercentage": 0, "route": [ { - "x": 1344, + "x": 718, "y": 234 }, { - "x": 1344, + "x": 718, "y": 2834 } ], @@ -1819,11 +1819,11 @@ "labelPercentage": 0, "route": [ { - "x": 1564, + "x": 793, "y": 234 }, { - "x": 1564, + "x": 793, "y": 2834 } ], @@ -1858,11 +1858,11 @@ "labelPercentage": 0, "route": [ { - "x": 1784, + "x": 868, "y": 234 }, { - "x": 1784, + "x": 868, "y": 2834 } ], @@ -1897,11 +1897,11 @@ "labelPercentage": 0, "route": [ { - "x": 2020, + "x": 943, "y": 234 }, { - "x": 2020, + "x": 943, "y": 2834 } ], @@ -1936,11 +1936,11 @@ "labelPercentage": 0, "route": [ { - "x": 2256, + "x": 1034, "y": 239 }, { - "x": 2256, + "x": 1034, "y": 2834 } ], @@ -1975,11 +1975,11 @@ "labelPercentage": 0, "route": [ { - "x": 2476, + "x": 1109, "y": 234 }, { - "x": 2476, + "x": 1109, "y": 2834 } ], @@ -2014,11 +2014,11 @@ "labelPercentage": 0, "route": [ { - "x": 2696, + "x": 1184, "y": 234 }, { - "x": 2696, + "x": 1184, "y": 2834 } ], @@ -2053,11 +2053,11 @@ "labelPercentage": 0, "route": [ { - "x": 2928.5, + "x": 1258.5, "y": 234 }, { - "x": 2928.5, + "x": 1258.5, "y": 2834 } ], @@ -2092,11 +2092,11 @@ "labelPercentage": 0, "route": [ { - "x": 3177.5, + "x": 1346.5, "y": 234 }, { - "x": 3177.5, + "x": 1346.5, "y": 2834 } ], @@ -2131,11 +2131,11 @@ "labelPercentage": 0, "route": [ { - "x": 3416, + "x": 1438, "y": 239 }, { - "x": 3416, + "x": 1438, "y": 2834 } ], @@ -2170,11 +2170,11 @@ "labelPercentage": 0, "route": [ { - "x": 3643.5, + "x": 1514.5, "y": 234 }, { - "x": 3643.5, + "x": 1514.5, "y": 2834 } ], @@ -2209,11 +2209,11 @@ "labelPercentage": 0, "route": [ { - "x": 3876.5, + "x": 1595.5, "y": 234 }, { - "x": 3876.5, + "x": 1595.5, "y": 2834 } ], @@ -2248,11 +2248,11 @@ "labelPercentage": 0, "route": [ { - "x": 4135.5, + "x": 1677.5, "y": 234 }, { - "x": 4135.5, + "x": 1677.5, "y": 2834 } ], @@ -2287,11 +2287,11 @@ "labelPercentage": 0, "route": [ { - "x": 4387, + "x": 1784, "y": 234 }, { - "x": 4387, + "x": 1784, "y": 2834 } ], @@ -2326,11 +2326,11 @@ "labelPercentage": 0, "route": [ { - "x": 4637, + "x": 1859, "y": 234 }, { - "x": 4637, + "x": 1859, "y": 2834 } ], diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg index 7e13b2b3a..80a3928b3 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg @@ -2,7 +2,7 @@ a labelblabelsa class+ +public() bool +void- +private() int +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid -int -name -varchar - result := callThisFunction(obj, 5) midthis sideother side - - - +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +int +name +varchar + result := callThisFunction(obj, 5) midthis sideother side + + + a labelblabelsa class+ -public() bool -void- -private() int -voidcloudyyyya := 5 +a labelblabelsa class+ +public() bool +void- +private() int +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid -int -name -varchar - result := callThisFunction(obj, 5) midthis sideother side - - - +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +int +name +varchar + result := callThisFunction(obj, 5) midthis sideother side + + + abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note - - - - - +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note + + + + + abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note - - - - - +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note + + + + + scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier - - +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier + + abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier - - +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier + + How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place - - - - - - - - - - - - - - +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place + + + + + + + + + + + + + + How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place - - - - - - - - - - - - - - +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place + + + + + + + + + + + + + + ab a self edge herebetween actorsto descendantto deeper descendantto parentactor - +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor + - - - - - + + + + + ab a self edge herebetween actorsto descendantto deeper descendantto parentactor - +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor + - - - - - + + + + + AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response - - - - - - - - - +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response + + + + + + + + + AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response - - - - - - - - - +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response + + + + + + + + + scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - - - - - - - - - - - - - +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + + + + + + + + + + + + + a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - - - - - - - - - - - - - +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + + + + + + + + + + + + + an actor with a really long label that will break everythinga short oneanactorwithareallylonglabelthatwillbreakeverythingsimple shortshortlong label for testing purposes and it must be really, really longlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actors - - - - - - - +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long + + + + + + an actor with a really long label that will break everythinga short oneanactorwithareallylonglabelthatwillbreakeverythingsimple shortshortlong label for testing purposes and it must be really, really longlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actors - - - - - - - +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long + + + + + + a labelblabelsa class+ -public() bool -void- -private() int -voidcloudyyyya := 5 +a labelblabelsa class+ +public() bool +void- +private() int +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid -int -name -varchar - result := callThisFunction(obj, 5) midthis sideother side - +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +int +name +varchar + result := callThisFunction(obj, 5) midthis sideother side + - + a labelblabelsa class+ -public() bool -void- -private() int -voidcloudyyyya := 5 +a labelblabelsa class+ +public() bool +void- +private() int +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid -int -name -varchar - result := callThisFunction(obj, 5) midthis sideother side - +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +int +name +varchar + result := callThisFunction(obj, 5) midthis sideother side + - + abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note - - - - - +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note + + + + + abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note - - - - - +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note + + + + + scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier - - +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier + + abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier - - +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier + + How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place - - - - - - - - - - - - - - +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place + + + + + + + + + + + + + + How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place - - - - - - - - - - - - - - +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place + + + + + + + + + + + + + + ab a self edge herebetween actorsto descendantto deeper descendantto parentactor - +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor + - - - - - + + + + + ab a self edge herebetween actorsto descendantto deeper descendantto parentactor - +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor + - - - - - + + + + + scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - - - - - - - - - - - - - +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + + + + + + + + + + + + + a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - - - - - - - - - - - - - +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + + + + + + + + + + + + + abc abc ab ab acbd acbd ab hello diff --git a/e2etests/testdata/sanity/connection_label/elk/board.exp.json b/e2etests/testdata/sanity/connection_label/elk/board.exp.json index 2680db2b1..be654cbef 100644 --- a/e2etests/testdata/sanity/connection_label/elk/board.exp.json +++ b/e2etests/testdata/sanity/connection_label/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/sanity/connection_label/elk/sketch.exp.svg b/e2etests/testdata/sanity/connection_label/elk/sketch.exp.svg index 72194bada..e4bf0727d 100644 --- a/e2etests/testdata/sanity/connection_label/elk/sketch.exp.svg +++ b/e2etests/testdata/sanity/connection_label/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="313" height="673" viewBox="-88 -88 313 673">ab hello diff --git a/e2etests/testdata/sanity/empty/dagre/sketch.exp.svg b/e2etests/testdata/sanity/empty/dagre/sketch.exp.svg index 5c521366b..f0384e16b 100644 --- a/e2etests/testdata/sanity/empty/dagre/sketch.exp.svg +++ b/e2etests/testdata/sanity/empty/dagre/sketch.exp.svg @@ -13,5 +13,9 @@ width="202" height="202" viewBox="9223372036854775707 9223372036854775707 202 20 stroke-linejoin: round; } +.blend { + mix-blend-mode: multiply; +} + ]]> \ No newline at end of file diff --git a/e2etests/testdata/sanity/empty/elk/sketch.exp.svg b/e2etests/testdata/sanity/empty/elk/sketch.exp.svg index 5c521366b..f0384e16b 100644 --- a/e2etests/testdata/sanity/empty/elk/sketch.exp.svg +++ b/e2etests/testdata/sanity/empty/elk/sketch.exp.svg @@ -13,5 +13,9 @@ width="202" height="202" viewBox="9223372036854775707 9223372036854775707 202 20 stroke-linejoin: round; } +.blend { + mix-blend-mode: multiply; +} + ]]> \ No newline at end of file diff --git a/e2etests/testdata/stable/all_shapes/dagre/board.exp.json b/e2etests/testdata/stable/all_shapes/dagre/board.exp.json index a86e092db..edc6e7bca 100644 --- a/e2etests/testdata/stable/all_shapes/dagre/board.exp.json +++ b/e2etests/testdata/stable/all_shapes/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -452,6 +463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -491,6 +503,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -530,6 +543,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -569,6 +583,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -608,6 +623,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -647,6 +663,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/all_shapes/dagre/sketch.exp.svg b/e2etests/testdata/stable/all_shapes/dagre/sketch.exp.svg index 43a253d77..a11c9919a 100644 --- a/e2etests/testdata/stable/all_shapes/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/all_shapes/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="1539" height="824" viewBox="-100 -100 1539 824">rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud diff --git a/e2etests/testdata/stable/all_shapes_shadow/elk/board.exp.json b/e2etests/testdata/stable/all_shapes_shadow/elk/board.exp.json index 4ed2ccd1d..03c629d51 100644 --- a/e2etests/testdata/stable/all_shapes_shadow/elk/board.exp.json +++ b/e2etests/testdata/stable/all_shapes_shadow/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -452,6 +463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -491,6 +503,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -530,6 +543,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -569,6 +583,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -608,6 +623,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -647,6 +663,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/all_shapes_shadow/elk/sketch.exp.svg b/e2etests/testdata/stable/all_shapes_shadow/elk/sketch.exp.svg index c8f03debb..6ad485443 100644 --- a/e2etests/testdata/stable/all_shapes_shadow/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/all_shapes_shadow/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="1352" height="824" viewBox="-88 -88 1352 824"> diff --git a/e2etests/testdata/stable/arrowhead_adjustment/dagre/board.exp.json b/e2etests/testdata/stable/arrowhead_adjustment/dagre/board.exp.json index 53e292e5b..382538056 100644 --- a/e2etests/testdata/stable/arrowhead_adjustment/dagre/board.exp.json +++ b/e2etests/testdata/stable/arrowhead_adjustment/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/arrowhead_adjustment/dagre/sketch.exp.svg b/e2etests/testdata/stable/arrowhead_adjustment/dagre/sketch.exp.svg index 21eddaa17..2ec107a86 100644 --- a/e2etests/testdata/stable/arrowhead_adjustment/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/arrowhead_adjustment/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="480" height="778" viewBox="-100 -100 480 778">cba * cba * ab To err is human, to moo bovine1* diff --git a/e2etests/testdata/stable/arrowhead_labels/elk/board.exp.json b/e2etests/testdata/stable/arrowhead_labels/elk/board.exp.json index 648d83fc8..97667ccc4 100644 --- a/e2etests/testdata/stable/arrowhead_labels/elk/board.exp.json +++ b/e2etests/testdata/stable/arrowhead_labels/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/arrowhead_labels/elk/sketch.exp.svg b/e2etests/testdata/stable/arrowhead_labels/elk/sketch.exp.svg index b2cd02bfb..fd34c4bad 100644 --- a/e2etests/testdata/stable/arrowhead_labels/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/arrowhead_labels/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="401" height="673" viewBox="14 -88 401 673">ab To err is human, to moo bovine1* diff --git a/e2etests/testdata/stable/binary_tree/dagre/board.exp.json b/e2etests/testdata/stable/binary_tree/dagre/board.exp.json index 92781dc2d..a8a2e2377 100644 --- a/e2etests/testdata/stable/binary_tree/dagre/board.exp.json +++ b/e2etests/testdata/stable/binary_tree/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -452,6 +463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -491,6 +503,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -530,6 +543,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -569,6 +583,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/binary_tree/dagre/sketch.exp.svg b/e2etests/testdata/stable/binary_tree/dagre/sketch.exp.svg index 4dc067779..0d18868a4 100644 --- a/e2etests/testdata/stable/binary_tree/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/binary_tree/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="1518" height="1004" viewBox="-100 -100 1518 1004">abcdefghijklmno abcdefghijklmno aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos1/elk/board.exp.json b/e2etests/testdata/stable/chaos1/elk/board.exp.json index a8b4d6e22..d7fcac07d 100644 --- a/e2etests/testdata/stable/chaos1/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos1/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg index d1d227fe1..41904b6b7 100644 --- a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="630" height="869" viewBox="-88 -88 630 869">aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos2/dagre/board.exp.json b/e2etests/testdata/stable/chaos2/dagre/board.exp.json index 04707eae5..c928b6a24 100644 --- a/e2etests/testdata/stable/chaos2/dagre/board.exp.json +++ b/e2etests/testdata/stable/chaos2/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -217,6 +222,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -256,6 +262,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -294,6 +301,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -333,6 +341,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -372,6 +381,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -411,6 +421,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -450,6 +461,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -489,6 +501,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -528,6 +541,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -566,6 +580,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg index 1e18f39e6..9459e4d9b 100644 --- a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="1317" height="1854" viewBox="-100 -100 1317 1854">abcd abcd abc abc BatchManager- num diff --git a/e2etests/testdata/stable/class/elk/board.exp.json b/e2etests/testdata/stable/class/elk/board.exp.json index 67427ed80..85549a957 100644 --- a/e2etests/testdata/stable/class/elk/board.exp.json +++ b/e2etests/testdata/stable/class/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": [ { "name": "num", diff --git a/e2etests/testdata/stable/class/elk/sketch.exp.svg b/e2etests/testdata/stable/class/elk/sketch.exp.svg index d8ed26ffe..4ab440c33 100644 --- a/e2etests/testdata/stable/class/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/class/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="539" height="568" viewBox="-88 -88 539 568">BatchManager- num diff --git a/e2etests/testdata/stable/code_snippet/dagre/board.exp.json b/e2etests/testdata/stable/code_snippet/dagre/board.exp.json index 6cd1e4202..c058364e1 100644 --- a/e2etests/testdata/stable/code_snippet/dagre/board.exp.json +++ b/e2etests/testdata/stable/code_snippet/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -61,6 +62,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -100,6 +102,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/code_snippet/dagre/sketch.exp.svg b/e2etests/testdata/stable/code_snippet/dagre/sketch.exp.svg index 5594e9403..fc08ed11c 100644 --- a/e2etests/testdata/stable/code_snippet/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/code_snippet/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="955" height="818" viewBox="-100 -100 955 818">// RegisterHash registers a function that returns a new instance of the given // hash function. This is intended to be called from the init function in diff --git a/e2etests/testdata/stable/code_snippet/elk/board.exp.json b/e2etests/testdata/stable/code_snippet/elk/board.exp.json index b8f8d107a..0004dd714 100644 --- a/e2etests/testdata/stable/code_snippet/elk/board.exp.json +++ b/e2etests/testdata/stable/code_snippet/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -61,6 +62,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -100,6 +102,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/code_snippet/elk/sketch.exp.svg b/e2etests/testdata/stable/code_snippet/elk/sketch.exp.svg index 9656a4a1d..c8c6982f2 100644 --- a/e2etests/testdata/stable/code_snippet/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/code_snippet/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="955" height="818" viewBox="-88 -88 955 818">// RegisterHash registers a function that returns a new instance of the given // hash function. This is intended to be called from the init function in diff --git a/e2etests/testdata/stable/connected_container/dagre/board.exp.json b/e2etests/testdata/stable/connected_container/dagre/board.exp.json index a3f8f7a7d..f16c21da4 100644 --- a/e2etests/testdata/stable/connected_container/dagre/board.exp.json +++ b/e2etests/testdata/stable/connected_container/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/connected_container/dagre/sketch.exp.svg b/e2etests/testdata/stable/connected_container/dagre/sketch.exp.svg index 7e3ba639a..ef178c1b5 100644 --- a/e2etests/testdata/stable/connected_container/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/connected_container/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="494" height="1178" viewBox="-100 -100 494 1178">acfbdhg acfbdhg agdfbhec agdfbhec abcdefghijklmnopq abcdefghijklmnopq finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot bacde21345abcde bacde21345abcde alphabeta gamma diff --git a/e2etests/testdata/stable/font_colors/elk/board.exp.json b/e2etests/testdata/stable/font_colors/elk/board.exp.json index 2766ed834..c7cbbba18 100644 --- a/e2etests/testdata/stable/font_colors/elk/board.exp.json +++ b/e2etests/testdata/stable/font_colors/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/font_colors/elk/sketch.exp.svg b/e2etests/testdata/stable/font_colors/elk/sketch.exp.svg index bdda7137b..d39ec3ce2 100644 --- a/e2etests/testdata/stable/font_colors/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/font_colors/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="345" height="673" viewBox="-88 -88 345 673">alphabeta gamma diff --git a/e2etests/testdata/stable/font_sizes/dagre/board.exp.json b/e2etests/testdata/stable/font_sizes/dagre/board.exp.json index 8550c2c31..3a91ea14e 100644 --- a/e2etests/testdata/stable/font_sizes/dagre/board.exp.json +++ b/e2etests/testdata/stable/font_sizes/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -452,6 +463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/font_sizes/dagre/sketch.exp.svg b/e2etests/testdata/stable/font_sizes/dagre/sketch.exp.svg index b3a5e27e9..98907b633 100644 --- a/e2etests/testdata/stable/font_sizes/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/font_sizes/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="2360" height="632" viewBox="-100 -100 2360 632">size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/font_sizes/elk/board.exp.json b/e2etests/testdata/stable/font_sizes/elk/board.exp.json index 2fcb8f721..2d5446e61 100644 --- a/e2etests/testdata/stable/font_sizes/elk/board.exp.json +++ b/e2etests/testdata/stable/font_sizes/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -452,6 +463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg index c69206fcb..3cddd5e5c 100644 --- a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="1965" height="793" viewBox="-88 -88 1965 793">size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json index 4d1de50b6..62256201b 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -61,6 +62,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -100,6 +102,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg index aa40b0cde..d5aa9cf56 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="3251" height="5500" viewBox="-100 -100 3251 5500">hellohelloab ab aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/investigate/elk/board.exp.json b/e2etests/testdata/stable/investigate/elk/board.exp.json index 8f9f4f4bf..19c07f20c 100644 --- a/e2etests/testdata/stable/investigate/elk/board.exp.json +++ b/e2etests/testdata/stable/investigate/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -463,6 +474,7 @@ "RawFragment": "" }, "iconPosition": "INSIDE_MIDDLE_CENTER", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -502,6 +514,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -552,6 +565,7 @@ "RawFragment": "" }, "iconPosition": "INSIDE_MIDDLE_CENTER", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -591,6 +605,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -630,6 +645,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -669,6 +685,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -708,6 +725,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -747,6 +765,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -786,6 +805,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -825,6 +845,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -864,6 +885,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -903,6 +925,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -942,6 +965,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -981,6 +1005,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1020,6 +1045,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1059,6 +1085,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1098,6 +1125,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1137,6 +1165,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1176,6 +1205,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1215,6 +1245,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg index cd4553a99..a9f7ef86d 100644 --- a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="860" height="4868" viewBox="-82 -88 860 4868">aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/large_arch/dagre/board.exp.json b/e2etests/testdata/stable/large_arch/dagre/board.exp.json index 9d3b17eff..f62e8f5a5 100644 --- a/e2etests/testdata/stable/large_arch/dagre/board.exp.json +++ b/e2etests/testdata/stable/large_arch/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -452,6 +463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -491,6 +503,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -530,6 +543,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -569,6 +583,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -608,6 +623,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -647,6 +663,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -686,6 +703,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -725,6 +743,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -764,6 +783,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -803,6 +823,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -842,6 +863,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -881,6 +903,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -920,6 +943,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -959,6 +983,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -998,6 +1023,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1037,6 +1063,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1076,6 +1103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1115,6 +1143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1154,6 +1183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1193,6 +1223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1232,6 +1263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1271,6 +1303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg index ee5c062cc..ad186e9a7 100644 --- a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="3244" height="1780" viewBox="-100 -100 3244 1780">abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv thisgoesmultiple linesthisgoesmultiple linesabcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstu abcdefghijklmnopqrstu Foo Baz12hello Foo Baz12hello acdefgbh acdefgbh topabcbottomstartend topabcbottomstartend xyz hello diff --git a/e2etests/testdata/stable/self-referencing/elk/board.exp.json b/e2etests/testdata/stable/self-referencing/elk/board.exp.json index 8ea3dd21a..36e35e83d 100644 --- a/e2etests/testdata/stable/self-referencing/elk/board.exp.json +++ b/e2etests/testdata/stable/self-referencing/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/self-referencing/elk/sketch.exp.svg b/e2etests/testdata/stable/self-referencing/elk/sketch.exp.svg index 058ea980c..6ac4cb479 100644 --- a/e2etests/testdata/stable/self-referencing/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/self-referencing/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="572" height="552" viewBox="-70 -88 572 552">xyz hello diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json index 56c919de8..590f243d9 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": [ { @@ -151,6 +154,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -190,6 +194,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -229,6 +234,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -268,6 +274,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -307,6 +314,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -346,6 +354,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -396,6 +405,7 @@ "RawFragment": "" }, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -435,6 +445,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -474,6 +485,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -513,6 +525,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -552,6 +565,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -591,6 +605,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -630,6 +645,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -669,6 +685,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -708,6 +725,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -747,6 +765,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -786,6 +805,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ @@ -1596,7 +1616,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(b -- )[0]", @@ -1635,7 +1655,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(c -- )[0]", @@ -1674,7 +1694,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(d -- )[0]", @@ -1713,7 +1733,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(e -- )[0]", @@ -1752,7 +1772,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(f -- )[0]", @@ -1791,7 +1811,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(g -- )[0]", @@ -1830,7 +1850,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(h -- )[0]", @@ -1869,7 +1889,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(i -- )[0]", @@ -1908,7 +1928,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(j -- )[0]", @@ -1947,7 +1967,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(k -- )[0]", @@ -1986,7 +2006,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(l -- )[0]", @@ -2025,7 +2045,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(m -- )[0]", @@ -2064,7 +2084,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(n -- )[0]", @@ -2103,7 +2123,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(o -- )[0]", @@ -2142,7 +2162,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(p -- )[0]", @@ -2181,7 +2201,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(q -- )[0]", @@ -2220,7 +2240,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(r -- )[0]", @@ -2259,7 +2279,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(s -- )[0]", @@ -2298,7 +2318,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(t -- )[0]", @@ -2337,7 +2357,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg index 03afbe816..23483b172 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="4908" height="2984" viewBox="-100 -50 4908 2984">a labelblabelsa class+ public() bool diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json index 56c919de8..590f243d9 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": [ { @@ -151,6 +154,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -190,6 +194,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -229,6 +234,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -268,6 +274,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -307,6 +314,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -346,6 +354,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -396,6 +405,7 @@ "RawFragment": "" }, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -435,6 +445,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -474,6 +485,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -513,6 +525,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -552,6 +565,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -591,6 +605,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -630,6 +645,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -669,6 +685,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -708,6 +725,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -747,6 +765,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -786,6 +805,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ @@ -1596,7 +1616,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(b -- )[0]", @@ -1635,7 +1655,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(c -- )[0]", @@ -1674,7 +1694,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(d -- )[0]", @@ -1713,7 +1733,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(e -- )[0]", @@ -1752,7 +1772,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(f -- )[0]", @@ -1791,7 +1811,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(g -- )[0]", @@ -1830,7 +1850,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(h -- )[0]", @@ -1869,7 +1889,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(i -- )[0]", @@ -1908,7 +1928,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(j -- )[0]", @@ -1947,7 +1967,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(k -- )[0]", @@ -1986,7 +2006,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(l -- )[0]", @@ -2025,7 +2045,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(m -- )[0]", @@ -2064,7 +2084,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(n -- )[0]", @@ -2103,7 +2123,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(o -- )[0]", @@ -2142,7 +2162,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(p -- )[0]", @@ -2181,7 +2201,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(q -- )[0]", @@ -2220,7 +2240,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(r -- )[0]", @@ -2259,7 +2279,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(s -- )[0]", @@ -2298,7 +2318,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(t -- )[0]", @@ -2337,7 +2357,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg index 03afbe816..23483b172 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="4908" height="2984" viewBox="-100 -50 4908 2984">a labelblabelsa class+ public() bool diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json index d3b8d9c6a..49d702816 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -192,7 +197,7 @@ "underline": false, "labelWidth": 30, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 1 }, { @@ -217,6 +222,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -230,7 +236,7 @@ "underline": false, "labelWidth": 57, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 1 }, { @@ -255,6 +261,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -268,7 +275,7 @@ "underline": false, "labelWidth": 78, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 2 }, { @@ -293,6 +300,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -306,7 +314,7 @@ "underline": false, "labelWidth": 58, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 1 }, { @@ -331,6 +339,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -370,6 +379,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -383,7 +393,7 @@ "underline": false, "labelWidth": 38, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 1 }, { @@ -408,6 +418,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -447,6 +458,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -460,7 +472,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -485,6 +497,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -498,7 +511,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -523,6 +536,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -536,7 +550,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 } ], @@ -968,7 +982,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(b -- )[0]", @@ -1007,7 +1021,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(c -- )[0]", @@ -1046,7 +1060,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(d -- )[0]", @@ -1085,7 +1099,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg index 2998278f8..42148947f 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg @@ -13,8 +13,12 @@ width="1057" height="2268" viewBox="-100 -50 1057 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json index d3b8d9c6a..49d702816 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -192,7 +197,7 @@ "underline": false, "labelWidth": 30, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 1 }, { @@ -217,6 +222,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -230,7 +236,7 @@ "underline": false, "labelWidth": 57, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 1 }, { @@ -255,6 +261,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -268,7 +275,7 @@ "underline": false, "labelWidth": 78, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 2 }, { @@ -293,6 +300,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -306,7 +314,7 @@ "underline": false, "labelWidth": 58, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 1 }, { @@ -331,6 +339,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -370,6 +379,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -383,7 +393,7 @@ "underline": false, "labelWidth": 38, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 1 }, { @@ -408,6 +418,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -447,6 +458,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -460,7 +472,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -485,6 +497,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -498,7 +511,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -523,6 +536,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -536,7 +550,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 } ], @@ -968,7 +982,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(b -- )[0]", @@ -1007,7 +1021,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(c -- )[0]", @@ -1046,7 +1060,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(d -- )[0]", @@ -1085,7 +1099,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg index 2998278f8..42148947f 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg @@ -13,8 +13,12 @@ width="1057" height="2268" viewBox="-100 -50 1057 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/board.exp.json index 5b1b197f4..705a340e1 100644 --- a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -75,7 +77,7 @@ "underline": false, "labelWidth": 29, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -100,6 +102,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -139,6 +142,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -152,7 +156,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -177,6 +181,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -216,6 +221,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -229,7 +235,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -254,6 +260,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -267,7 +274,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -292,6 +299,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -331,6 +339,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -344,7 +353,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -369,6 +378,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -382,7 +392,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -407,6 +417,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -420,7 +431,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -445,6 +456,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -484,6 +496,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -497,7 +510,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -522,6 +535,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -535,7 +549,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -560,6 +574,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -573,7 +588,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -598,6 +613,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -611,7 +627,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -636,6 +652,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -675,6 +692,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -688,7 +706,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -713,6 +731,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -726,7 +745,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -751,6 +770,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -764,7 +784,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -789,6 +809,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -802,7 +823,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -827,6 +848,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -840,7 +862,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 6 }, { @@ -865,6 +887,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -878,7 +901,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 } ], @@ -1271,7 +1294,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(itemResponse -- )[0]", @@ -1310,7 +1333,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(item -- )[0]", @@ -1349,7 +1372,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(essayRubric -- )[0]", @@ -1388,7 +1411,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(concept -- )[0]", @@ -1427,7 +1450,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(itemOutcome -- )[0]", @@ -1466,7 +1489,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg index f2bb4e085..4d41134f1 100644 --- a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="1593" height="1626" viewBox="-100 -50 1593 1626">scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json index a1170b628..2bec690f8 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": true, "fields": null, "methods": null, "columns": null, @@ -387,7 +397,7 @@ "underline": false, "labelWidth": 185, "labelHeight": 26, - "zIndex": 1, + "zIndex": 3, "level": 2 }, { @@ -412,6 +422,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -425,7 +436,7 @@ "underline": false, "labelWidth": 47, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -450,6 +461,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -489,6 +501,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -528,6 +541,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -541,7 +555,7 @@ "underline": false, "labelWidth": 50, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 } ], @@ -1090,7 +1104,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2ast -- )[0]", @@ -1129,7 +1143,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2compiler -- )[0]", @@ -1168,7 +1182,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2layout -- )[0]", @@ -1207,7 +1221,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2exporter -- )[0]", @@ -1246,7 +1260,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2themes -- )[0]", @@ -1285,7 +1299,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2renderer -- )[0]", @@ -1324,7 +1338,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2sequencelayout -- )[0]", @@ -1363,7 +1377,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(How this is rendered.d2dagrelayout -- )[0]", @@ -1402,7 +1416,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg index 58f501629..1a00cde91 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg @@ -13,8 +13,12 @@ width="2374" height="2488" viewBox="-88 -88 2374 2488">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json index add1b4166..ce886a711 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -114,7 +117,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -139,6 +142,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -152,7 +156,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -177,6 +181,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -190,7 +195,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -215,6 +220,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -228,7 +234,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -253,6 +259,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -266,7 +273,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 } ], @@ -613,7 +620,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(b -- )[0]", @@ -652,7 +659,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg index f604a0366..a80bfc5fa 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="666" height="1366" viewBox="-100 -50 666 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json index add1b4166..ce886a711 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -114,7 +117,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -139,6 +142,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -152,7 +156,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -177,6 +181,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -190,7 +195,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -215,6 +220,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -228,7 +234,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -253,6 +259,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -266,7 +273,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 } ], @@ -613,7 +620,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(b -- )[0]", @@ -652,7 +659,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg index f604a0366..a80bfc5fa 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="666" height="1366" viewBox="-100 -50 666 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json index 83e4e6302..16d4b8a6e 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -625,7 +630,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(bob -- )[0]", @@ -664,7 +669,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(db -- )[0]", @@ -703,7 +708,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(queue -- )[0]", @@ -742,7 +747,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(service -- )[0]", @@ -781,7 +786,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg index 40e95fbe8..0b8022575 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="1285" height="1868" viewBox="-100 -50 1285 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json index 83e4e6302..16d4b8a6e 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -625,7 +630,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(bob -- )[0]", @@ -664,7 +669,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(db -- )[0]", @@ -703,7 +708,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(queue -- )[0]", @@ -742,7 +747,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(service -- )[0]", @@ -781,7 +786,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg index 40e95fbe8..0b8022575 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="1285" height="1868" viewBox="-100 -50 1285 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json index ec7d0c273..77a314e56 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -75,7 +77,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -100,6 +102,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -139,6 +142,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -152,7 +156,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -177,6 +181,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -216,6 +221,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -229,7 +235,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -254,6 +260,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -293,6 +300,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -306,7 +314,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -331,6 +339,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -344,7 +353,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -369,6 +378,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -408,6 +418,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -421,7 +432,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -446,6 +457,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -485,6 +497,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -498,7 +511,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -523,6 +536,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -536,7 +550,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -561,6 +575,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -574,7 +589,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -599,6 +614,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -612,7 +628,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -637,6 +653,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -650,7 +667,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 } ], @@ -1199,7 +1216,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(itemResponse -- )[0]", @@ -1238,7 +1255,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(item -- )[0]", @@ -1277,7 +1294,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(essayRubric -- )[0]", @@ -1316,7 +1333,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(concept -- )[0]", @@ -1355,7 +1372,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(itemOutcome -- )[0]", @@ -1394,7 +1411,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg index 062ed1eed..1a0f7f184 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="1593" height="2146" viewBox="-100 -50 1593 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json index ec7d0c273..77a314e56 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -75,7 +77,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -100,6 +102,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -139,6 +142,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -152,7 +156,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -177,6 +181,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -216,6 +221,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -229,7 +235,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -254,6 +260,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -293,6 +300,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -306,7 +314,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -331,6 +339,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -344,7 +353,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -369,6 +378,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -408,6 +418,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -421,7 +432,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -446,6 +457,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -485,6 +497,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -498,7 +511,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -523,6 +536,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -536,7 +550,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -561,6 +575,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -574,7 +589,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -599,6 +614,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -612,7 +628,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 }, { @@ -637,6 +653,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -650,7 +667,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 2 } ], @@ -1199,7 +1216,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(itemResponse -- )[0]", @@ -1238,7 +1255,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(item -- )[0]", @@ -1277,7 +1294,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(essayRubric -- )[0]", @@ -1316,7 +1333,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(concept -- )[0]", @@ -1355,7 +1372,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(itemOutcome -- )[0]", @@ -1394,7 +1411,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg index 062ed1eed..1a0f7f184 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="1593" height="2146" viewBox="-100 -50 1593 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json index 9416101ce..e3eac2402 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -452,6 +463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -491,6 +503,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -530,6 +543,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -543,7 +557,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -568,6 +582,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -607,6 +622,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -620,7 +636,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -645,6 +661,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -684,6 +701,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -697,7 +715,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -722,6 +740,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -761,6 +780,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -774,7 +794,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -799,6 +819,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -812,7 +833,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -837,6 +858,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -876,6 +898,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -889,7 +912,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -914,6 +937,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -953,6 +977,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -966,7 +991,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -991,6 +1016,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1004,7 +1030,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -1029,6 +1055,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1042,7 +1069,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -1067,6 +1094,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1080,7 +1108,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -1105,6 +1133,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1118,7 +1147,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -1143,6 +1172,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1182,6 +1212,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1195,7 +1226,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1220,6 +1251,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1259,6 +1291,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1272,7 +1305,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1297,6 +1330,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1336,6 +1370,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1349,7 +1384,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1374,6 +1409,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1413,6 +1449,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1426,7 +1463,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1451,6 +1488,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1464,7 +1502,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -1489,6 +1527,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1528,6 +1567,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1541,7 +1581,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1566,6 +1606,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1605,6 +1646,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1618,7 +1660,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1643,6 +1685,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1656,7 +1699,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1681,6 +1724,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1694,7 +1738,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1719,6 +1763,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1732,7 +1777,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1757,6 +1802,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1770,7 +1816,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1795,6 +1841,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1834,6 +1881,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1847,7 +1895,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1872,6 +1920,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1885,7 +1934,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1910,6 +1959,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1923,7 +1973,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -1948,6 +1998,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1961,7 +2012,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1986,6 +2037,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1999,7 +2051,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -2024,6 +2076,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2037,7 +2090,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 6 }, { @@ -2062,6 +2115,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2075,7 +2129,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -2100,6 +2154,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2113,7 +2168,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -2138,6 +2193,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2151,7 +2207,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 6 }, { @@ -2176,6 +2232,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2189,7 +2246,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 7 }, { @@ -2214,6 +2271,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2227,7 +2285,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -2252,6 +2310,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2265,7 +2324,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -2290,6 +2349,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2303,7 +2363,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 6 }, { @@ -2328,6 +2388,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2341,7 +2402,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 7 }, { @@ -2366,6 +2427,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2379,7 +2441,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 8 }, { @@ -2404,6 +2466,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2417,7 +2480,7 @@ "underline": false, "labelWidth": 29, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -2442,6 +2505,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2455,7 +2519,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 } ], @@ -4123,7 +4187,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.itemResponse -- )[0]", @@ -4162,7 +4226,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.item -- )[0]", @@ -4201,7 +4265,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.essayRubric -- )[0]", @@ -4240,7 +4304,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.concept -- )[0]", @@ -4279,7 +4343,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.itemOutcome -- )[0]", @@ -4318,7 +4382,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.scorer -- )[0]", @@ -4357,7 +4421,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.itemResponse -- )[0]", @@ -4396,7 +4460,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.item -- )[0]", @@ -4435,7 +4499,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.essayRubric -- )[0]", @@ -4474,7 +4538,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.concept -- )[0]", @@ -4513,7 +4577,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.itemOutcome -- )[0]", @@ -4552,7 +4616,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.scorer -- )[0]", @@ -4591,7 +4655,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.concept -- )[0]", @@ -4630,7 +4694,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.essayRubric -- )[0]", @@ -4669,7 +4733,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.item -- )[0]", @@ -4708,7 +4772,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.itemOutcome -- )[0]", @@ -4747,7 +4811,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.itemResponse -- )[0]", @@ -4786,7 +4850,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg index 5c7e8ffd3..25f5aa192 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="3244" height="4173" viewBox="-100 -100 3244 4173">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json index 65f9beec9..005c6a567 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -452,6 +463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -491,6 +503,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -530,6 +543,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -543,7 +557,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -568,6 +582,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -607,6 +622,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -620,7 +636,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -645,6 +661,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -684,6 +701,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -697,7 +715,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -722,6 +740,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -761,6 +780,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -774,7 +794,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -799,6 +819,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -812,7 +833,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -837,6 +858,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -876,6 +898,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -889,7 +912,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -914,6 +937,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -953,6 +977,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -966,7 +991,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -991,6 +1016,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1004,7 +1030,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -1029,6 +1055,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1042,7 +1069,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -1067,6 +1094,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1080,7 +1108,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -1105,6 +1133,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1118,7 +1147,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 3 }, { @@ -1143,6 +1172,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1182,6 +1212,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1195,7 +1226,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1220,6 +1251,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1259,6 +1291,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1272,7 +1305,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1297,6 +1330,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1336,6 +1370,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1349,7 +1384,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1374,6 +1409,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1413,6 +1449,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1426,7 +1463,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1451,6 +1488,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1464,7 +1502,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -1489,6 +1527,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1528,6 +1567,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1541,7 +1581,7 @@ "underline": false, "labelWidth": 11, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1566,6 +1606,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1605,6 +1646,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1618,7 +1660,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1643,6 +1685,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1656,7 +1699,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1681,6 +1724,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1694,7 +1738,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1719,6 +1763,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1732,7 +1777,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1757,6 +1802,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1770,7 +1816,7 @@ "underline": false, "labelWidth": 19, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1795,6 +1841,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1834,6 +1881,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1847,7 +1895,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1872,6 +1920,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1885,7 +1934,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1910,6 +1959,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1923,7 +1973,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -1948,6 +1998,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1961,7 +2012,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -1986,6 +2037,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1999,7 +2051,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -2024,6 +2076,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2037,7 +2090,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 6 }, { @@ -2062,6 +2115,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2075,7 +2129,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -2100,6 +2154,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2113,7 +2168,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -2138,6 +2193,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2151,7 +2207,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 6 }, { @@ -2176,6 +2232,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2189,7 +2246,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 7 }, { @@ -2214,6 +2271,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2227,7 +2285,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -2252,6 +2310,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2265,7 +2324,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 5 }, { @@ -2290,6 +2349,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2303,7 +2363,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 6 }, { @@ -2328,6 +2388,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2341,7 +2402,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 7 }, { @@ -2366,6 +2427,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2379,7 +2441,7 @@ "underline": false, "labelWidth": 13, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 8 }, { @@ -2404,6 +2466,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2417,7 +2480,7 @@ "underline": false, "labelWidth": 29, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 }, { @@ -2442,6 +2505,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -2455,7 +2519,7 @@ "underline": false, "labelWidth": 12, "labelHeight": 26, - "zIndex": 3, + "zIndex": 2, "level": 4 } ], @@ -4042,7 +4106,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.itemResponse -- )[0]", @@ -4081,7 +4145,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.item -- )[0]", @@ -4120,7 +4184,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.essayRubric -- )[0]", @@ -4159,7 +4223,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.concept -- )[0]", @@ -4198,7 +4262,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(a_sequence.itemOutcome -- )[0]", @@ -4237,7 +4301,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.scorer -- )[0]", @@ -4276,7 +4340,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.itemResponse -- )[0]", @@ -4315,7 +4379,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.item -- )[0]", @@ -4354,7 +4418,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.essayRubric -- )[0]", @@ -4393,7 +4457,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.concept -- )[0]", @@ -4432,7 +4496,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(another.sequence.itemOutcome -- )[0]", @@ -4471,7 +4535,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.scorer -- )[0]", @@ -4510,7 +4574,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.concept -- )[0]", @@ -4549,7 +4613,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.essayRubric -- )[0]", @@ -4588,7 +4652,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.item -- )[0]", @@ -4627,7 +4691,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.itemOutcome -- )[0]", @@ -4666,7 +4730,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 }, { "id": "(finally.sequence.itemResponse -- )[0]", @@ -4705,7 +4769,7 @@ "animated": false, "tooltip": "", "icon": null, - "zIndex": 2 + "zIndex": 1 } ] } diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg index c37e331bd..3a7627648 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="3166" height="4293" viewBox="-88 -88 3166 4293">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sql_tables/dagre/board.exp.json b/e2etests/testdata/stable/sql_tables/dagre/board.exp.json index e4f5b8038..b6e0dfc1d 100644 --- a/e2etests/testdata/stable/sql_tables/dagre/board.exp.json +++ b/e2etests/testdata/stable/sql_tables/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ @@ -92,6 +93,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ @@ -155,6 +157,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ @@ -212,6 +215,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ diff --git a/e2etests/testdata/stable/sql_tables/dagre/sketch.exp.svg b/e2etests/testdata/stable/sql_tables/dagre/sketch.exp.svg index 38c496a68..0c338a4cb 100644 --- a/e2etests/testdata/stable/sql_tables/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sql_tables/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="1162" height="660" viewBox="-100 -100 1162 660">usersid int diff --git a/e2etests/testdata/stable/sql_tables/elk/board.exp.json b/e2etests/testdata/stable/sql_tables/elk/board.exp.json index 4580c1251..2734f02ca 100644 --- a/e2etests/testdata/stable/sql_tables/elk/board.exp.json +++ b/e2etests/testdata/stable/sql_tables/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ @@ -92,6 +93,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ @@ -155,6 +157,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ @@ -212,6 +215,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": [ diff --git a/e2etests/testdata/stable/sql_tables/elk/sketch.exp.svg b/e2etests/testdata/stable/sql_tables/elk/sketch.exp.svg index 82f2f84a6..83676385c 100644 --- a/e2etests/testdata/stable/sql_tables/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sql_tables/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="1082" height="660" viewBox="-88 -88 1082 660">usersid int diff --git a/e2etests/testdata/stable/square_3d/dagre/board.exp.json b/e2etests/testdata/stable/square_3d/dagre/board.exp.json index 1271b3d7c..8a037500b 100644 --- a/e2etests/testdata/stable/square_3d/dagre/board.exp.json +++ b/e2etests/testdata/stable/square_3d/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg index 0ccdd04b2..c0c23fd03 100644 --- a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="371" height="580" viewBox="-100 -100 371 580"> diff --git a/e2etests/testdata/stable/square_3d/elk/board.exp.json b/e2etests/testdata/stable/square_3d/elk/board.exp.json index e2493608c..e7bf89b84 100644 --- a/e2etests/testdata/stable/square_3d/elk/board.exp.json +++ b/e2etests/testdata/stable/square_3d/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/square_3d/elk/sketch.exp.svg b/e2etests/testdata/stable/square_3d/elk/sketch.exp.svg index 79cb89863..eac82185e 100644 --- a/e2etests/testdata/stable/square_3d/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/square_3d/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="371" height="580" viewBox="-88 -88 371 580"> diff --git a/e2etests/testdata/stable/straight_hierarchy_container/dagre/board.exp.json b/e2etests/testdata/stable/straight_hierarchy_container/dagre/board.exp.json index e08955990..00913a3e3 100644 --- a/e2etests/testdata/stable/straight_hierarchy_container/dagre/board.exp.json +++ b/e2etests/testdata/stable/straight_hierarchy_container/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -452,6 +463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -491,6 +503,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -530,6 +543,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -569,6 +583,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -608,6 +623,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -647,6 +663,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -686,6 +703,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -725,6 +743,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -764,6 +783,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -803,6 +823,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -842,6 +863,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -881,6 +903,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -920,6 +943,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -959,6 +983,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/straight_hierarchy_container/dagre/sketch.exp.svg b/e2etests/testdata/stable/straight_hierarchy_container/dagre/sketch.exp.svg index 1a5168cc1..4deaf1d99 100644 --- a/e2etests/testdata/stable/straight_hierarchy_container/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/straight_hierarchy_container/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="999" height="1730" viewBox="-100 -100 999 1730">acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc diff --git a/e2etests/testdata/stable/stylish/elk/board.exp.json b/e2etests/testdata/stable/stylish/elk/board.exp.json index 7df611198..0cd252c22 100644 --- a/e2etests/testdata/stable/stylish/elk/board.exp.json +++ b/e2etests/testdata/stable/stylish/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/stylish/elk/sketch.exp.svg b/e2etests/testdata/stable/stylish/elk/sketch.exp.svg index da08d2875..13fba9861 100644 --- a/e2etests/testdata/stable/stylish/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/stylish/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="314" height="552" viewBox="-88 -88 314 552"> diff --git a/e2etests/testdata/stable/transparent_3d/dagre/board.exp.json b/e2etests/testdata/stable/transparent_3d/dagre/board.exp.json index f2de4f323..c19a78f8f 100644 --- a/e2etests/testdata/stable/transparent_3d/dagre/board.exp.json +++ b/e2etests/testdata/stable/transparent_3d/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/transparent_3d/dagre/sketch.exp.svg b/e2etests/testdata/stable/transparent_3d/dagre/sketch.exp.svg index 9fed45499..1a7a77d81 100644 --- a/e2etests/testdata/stable/transparent_3d/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/transparent_3d/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="339" height="326" viewBox="-100 -100 339 326"> diff --git a/e2etests/testdata/stable/transparent_3d/elk/board.exp.json b/e2etests/testdata/stable/transparent_3d/elk/board.exp.json index 41cb8cf6f..cbdf1ca4e 100644 --- a/e2etests/testdata/stable/transparent_3d/elk/board.exp.json +++ b/e2etests/testdata/stable/transparent_3d/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/transparent_3d/elk/sketch.exp.svg b/e2etests/testdata/stable/transparent_3d/elk/sketch.exp.svg index e5e521a73..b795f5be6 100644 --- a/e2etests/testdata/stable/transparent_3d/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/transparent_3d/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="339" height="326" viewBox="-88 -88 339 326"> diff --git a/e2etests/testdata/stable/us_map/dagre/board.exp.json b/e2etests/testdata/stable/us_map/dagre/board.exp.json index b5ba0c1f4..6deece116 100644 --- a/e2etests/testdata/stable/us_map/dagre/board.exp.json +++ b/e2etests/testdata/stable/us_map/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -218,6 +223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -257,6 +263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -296,6 +303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -335,6 +343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -374,6 +383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -413,6 +423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -452,6 +463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -491,6 +503,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -530,6 +543,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -569,6 +583,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -608,6 +623,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -647,6 +663,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -686,6 +703,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -725,6 +743,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -764,6 +783,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -803,6 +823,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -842,6 +863,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -881,6 +903,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -920,6 +943,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -959,6 +983,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -998,6 +1023,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1037,6 +1063,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1076,6 +1103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1115,6 +1143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1154,6 +1183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1193,6 +1223,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1232,6 +1263,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1271,6 +1303,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1310,6 +1343,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1349,6 +1383,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1388,6 +1423,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1427,6 +1463,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1466,6 +1503,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1505,6 +1543,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1544,6 +1583,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1583,6 +1623,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1622,6 +1663,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1661,6 +1703,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1700,6 +1743,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1739,6 +1783,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1778,6 +1823,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1817,6 +1863,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1856,6 +1903,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1895,6 +1943,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -1934,6 +1983,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/us_map/dagre/sketch.exp.svg b/e2etests/testdata/stable/us_map/dagre/sketch.exp.svg index 3f27041e4..6b5170205 100644 --- a/e2etests/testdata/stable/us_map/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/us_map/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="3322" height="2812" viewBox="-100 -100 3322 2812">AKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDcontainerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json index 251a3afc2..35b0e5dd0 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json +++ b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg index 74e591fac..a08856cdb 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="536" height="663" viewBox="-88 -88 536 663">containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json index 3928b93ed..f3951de5d 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg index f3e3f7b1a..250e39b0a 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="664" height="716" viewBox="-100 -100 664 716">ninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneighteightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json index 03661ef73..d012e76be 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -101,6 +103,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -140,6 +143,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -179,6 +183,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg index 0a92d5cc1..1fc75eb20 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="789" height="2014" viewBox="-39 -88 789 2014">eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/tall_edge_label/dagre/board.exp.json b/e2etests/testdata/todo/tall_edge_label/dagre/board.exp.json index 4f763c08b..4050c622f 100644 --- a/e2etests/testdata/todo/tall_edge_label/dagre/board.exp.json +++ b/e2etests/testdata/todo/tall_edge_label/dagre/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/todo/tall_edge_label/dagre/sketch.exp.svg b/e2etests/testdata/todo/tall_edge_label/dagre/sketch.exp.svg index 9077c2058..6f91b89c2 100644 --- a/e2etests/testdata/todo/tall_edge_label/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/tall_edge_label/dagre/sketch.exp.svg @@ -13,6 +13,10 @@ width="313" height="552" viewBox="-100 -100 313 552">ab Thereoncewasaverytalledgelabel diff --git a/e2etests/testdata/todo/tall_edge_label/elk/board.exp.json b/e2etests/testdata/todo/tall_edge_label/elk/board.exp.json index 1d7e56a74..be7edc7f0 100644 --- a/e2etests/testdata/todo/tall_edge_label/elk/board.exp.json +++ b/e2etests/testdata/todo/tall_edge_label/elk/board.exp.json @@ -23,6 +23,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, @@ -62,6 +63,7 @@ "link": "", "icon": null, "iconPosition": "", + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/todo/tall_edge_label/elk/sketch.exp.svg b/e2etests/testdata/todo/tall_edge_label/elk/sketch.exp.svg index b270e215c..94bbf2b26 100644 --- a/e2etests/testdata/todo/tall_edge_label/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/tall_edge_label/elk/sketch.exp.svg @@ -13,6 +13,10 @@ width="313" height="785" viewBox="-88 -88 313 785">ab Thereoncewasaverytalledgelabel From bed4ef7fae6c38fefa1e2887eaa3315c37ee22c9 Mon Sep 17 00:00:00 2001 From: Alexander Wang Date: Mon, 5 Dec 2022 11:36:19 -0800 Subject: [PATCH 07/29] fix group classification --- d2graph/seqdiagram.go | 24 ++++++++++++++++++- d2renderers/d2svg/style.css | 1 - .../sanity/1_to_2/dagre/sketch.exp.svg | 1 - .../testdata/sanity/1_to_2/elk/sketch.exp.svg | 1 - .../sanity/basic/dagre/sketch.exp.svg | 1 - .../testdata/sanity/basic/elk/sketch.exp.svg | 1 - .../child_to_child/dagre/sketch.exp.svg | 1 - .../sanity/child_to_child/elk/sketch.exp.svg | 1 - .../connection_label/dagre/sketch.exp.svg | 1 - .../connection_label/elk/sketch.exp.svg | 1 - .../sanity/empty/dagre/sketch.exp.svg | 1 - .../testdata/sanity/empty/elk/sketch.exp.svg | 1 - .../stable/all_shapes/dagre/sketch.exp.svg | 1 - .../stable/all_shapes/elk/sketch.exp.svg | 1 - .../all_shapes_multiple/dagre/sketch.exp.svg | 1 - .../all_shapes_multiple/elk/sketch.exp.svg | 1 - .../all_shapes_shadow/dagre/sketch.exp.svg | 1 - .../all_shapes_shadow/elk/sketch.exp.svg | 1 - .../arrowhead_adjustment/dagre/sketch.exp.svg | 1 - .../arrowhead_adjustment/elk/sketch.exp.svg | 1 - .../arrowhead_labels/dagre/sketch.exp.svg | 1 - .../arrowhead_labels/elk/sketch.exp.svg | 1 - .../stable/binary_tree/dagre/sketch.exp.svg | 1 - .../stable/binary_tree/elk/sketch.exp.svg | 1 - .../stable/chaos1/dagre/sketch.exp.svg | 1 - .../testdata/stable/chaos1/elk/sketch.exp.svg | 1 - .../stable/chaos2/dagre/sketch.exp.svg | 1 - .../testdata/stable/chaos2/elk/sketch.exp.svg | 1 - .../child_parent_edges/dagre/sketch.exp.svg | 1 - .../child_parent_edges/elk/sketch.exp.svg | 1 - .../circular_dependency/dagre/sketch.exp.svg | 1 - .../circular_dependency/elk/sketch.exp.svg | 1 - .../stable/class/dagre/sketch.exp.svg | 1 - .../testdata/stable/class/elk/sketch.exp.svg | 1 - .../stable/code_snippet/dagre/sketch.exp.svg | 1 - .../stable/code_snippet/elk/sketch.exp.svg | 1 - .../connected_container/dagre/sketch.exp.svg | 1 - .../connected_container/elk/sketch.exp.svg | 1 - .../container_edges/dagre/sketch.exp.svg | 1 - .../stable/container_edges/elk/sketch.exp.svg | 1 - .../stable/dense/dagre/sketch.exp.svg | 1 - .../testdata/stable/dense/elk/sketch.exp.svg | 1 - .../different_subgraphs/dagre/sketch.exp.svg | 1 - .../different_subgraphs/elk/sketch.exp.svg | 1 - .../stable/direction/dagre/sketch.exp.svg | 1 - .../stable/direction/elk/sketch.exp.svg | 1 - .../stable/font_colors/dagre/sketch.exp.svg | 1 - .../stable/font_colors/elk/sketch.exp.svg | 1 - .../stable/font_sizes/dagre/sketch.exp.svg | 1 - .../stable/font_sizes/elk/sketch.exp.svg | 1 - .../giant_markdown_test/dagre/sketch.exp.svg | 1 - .../giant_markdown_test/elk/sketch.exp.svg | 1 - .../testdata/stable/hr/dagre/sketch.exp.svg | 1 - .../testdata/stable/hr/elk/sketch.exp.svg | 1 - .../stable/icon-label/dagre/sketch.exp.svg | 1 - .../stable/icon-label/elk/sketch.exp.svg | 1 - .../stable/images/dagre/sketch.exp.svg | 1 - .../testdata/stable/images/elk/sketch.exp.svg | 1 - .../stable/investigate/dagre/sketch.exp.svg | 1 - .../stable/investigate/elk/sketch.exp.svg | 1 - .../stable/large_arch/dagre/sketch.exp.svg | 1 - .../stable/large_arch/elk/sketch.exp.svg | 1 - .../stable/latex/dagre/sketch.exp.svg | 1 - .../testdata/stable/latex/elk/sketch.exp.svg | 1 - .../testdata/stable/li1/dagre/sketch.exp.svg | 1 - .../testdata/stable/li1/elk/sketch.exp.svg | 1 - .../testdata/stable/li2/dagre/sketch.exp.svg | 1 - .../testdata/stable/li2/elk/sketch.exp.svg | 1 - .../testdata/stable/li3/dagre/sketch.exp.svg | 1 - .../testdata/stable/li3/elk/sketch.exp.svg | 1 - .../testdata/stable/li4/dagre/sketch.exp.svg | 1 - .../testdata/stable/li4/elk/sketch.exp.svg | 1 - .../stable/lone_h1/dagre/sketch.exp.svg | 1 - .../stable/lone_h1/elk/sketch.exp.svg | 1 - .../stable/markdown/dagre/sketch.exp.svg | 1 - .../stable/markdown/elk/sketch.exp.svg | 1 - .../md_2space_newline/dagre/sketch.exp.svg | 1 - .../md_2space_newline/elk/sketch.exp.svg | 1 - .../md_backslash_newline/dagre/sketch.exp.svg | 1 - .../md_backslash_newline/elk/sketch.exp.svg | 1 - .../md_code_block_fenced/dagre/sketch.exp.svg | 1 - .../md_code_block_fenced/elk/sketch.exp.svg | 1 - .../dagre/sketch.exp.svg | 1 - .../md_code_block_indented/elk/sketch.exp.svg | 1 - .../md_code_inline/dagre/sketch.exp.svg | 1 - .../stable/md_code_inline/elk/sketch.exp.svg | 1 - .../multiline_text/dagre/sketch.exp.svg | 1 - .../stable/multiline_text/elk/sketch.exp.svg | 1 - .../multiple_trees/dagre/sketch.exp.svg | 1 - .../stable/multiple_trees/elk/sketch.exp.svg | 1 - .../stable/n22_e32/dagre/sketch.exp.svg | 1 - .../stable/n22_e32/elk/sketch.exp.svg | 1 - .../number_connections/dagre/sketch.exp.svg | 1 - .../number_connections/elk/sketch.exp.svg | 1 - .../one_container_loop/dagre/sketch.exp.svg | 1 - .../one_container_loop/elk/sketch.exp.svg | 1 - .../dagre/sketch.exp.svg | 1 - .../elk/sketch.exp.svg | 1 - .../testdata/stable/p/dagre/sketch.exp.svg | 1 - e2etests/testdata/stable/p/elk/sketch.exp.svg | 1 - .../testdata/stable/pre/dagre/sketch.exp.svg | 1 - .../testdata/stable/pre/elk/sketch.exp.svg | 1 - .../self-referencing/dagre/sketch.exp.svg | 1 - .../self-referencing/elk/sketch.exp.svg | 1 - .../dagre/sketch.exp.svg | 1 - .../elk/sketch.exp.svg | 1 - .../dagre/board.exp.json | 4 ++-- .../dagre/sketch.exp.svg | 3 +-- .../elk/board.exp.json | 4 ++-- .../elk/sketch.exp.svg | 3 +-- .../dagre/sketch.exp.svg | 1 - .../elk/sketch.exp.svg | 1 - .../dagre/board.exp.json | 8 +++---- .../dagre/sketch.exp.svg | 3 +-- .../sequence_diagram_note/elk/board.exp.json | 8 +++---- .../sequence_diagram_note/elk/sketch.exp.svg | 3 +-- .../dagre/board.exp.json | 2 +- .../dagre/sketch.exp.svg | 3 +-- .../sequence_diagram_real/elk/board.exp.json | 2 +- .../sequence_diagram_real/elk/sketch.exp.svg | 3 +-- .../dagre/sketch.exp.svg | 1 - .../elk/sketch.exp.svg | 1 - .../dagre/sketch.exp.svg | 1 - .../elk/sketch.exp.svg | 1 - .../dagre/sketch.exp.svg | 1 - .../sequence_diagram_span/elk/sketch.exp.svg | 1 - .../sequence_diagrams/dagre/sketch.exp.svg | 1 - .../sequence_diagrams/elk/sketch.exp.svg | 1 - .../stable/sql_tables/dagre/sketch.exp.svg | 1 - .../stable/sql_tables/elk/sketch.exp.svg | 1 - .../stable/square_3d/dagre/sketch.exp.svg | 1 - .../stable/square_3d/elk/sketch.exp.svg | 1 - .../dagre/sketch.exp.svg | 1 - .../elk/sketch.exp.svg | 1 - .../stable/stylish/dagre/sketch.exp.svg | 1 - .../stable/stylish/elk/sketch.exp.svg | 1 - .../transparent_3d/dagre/sketch.exp.svg | 1 - .../stable/transparent_3d/elk/sketch.exp.svg | 1 - .../stable/us_map/dagre/sketch.exp.svg | 1 - .../testdata/stable/us_map/elk/sketch.exp.svg | 1 - .../container_child_edge/dagre/sketch.exp.svg | 1 - .../container_child_edge/elk/sketch.exp.svg | 1 - .../dagre/sketch.exp.svg | 1 - .../elk/sketch.exp.svg | 1 - .../font_sizes_large/dagre/sketch.exp.svg | 1 - .../todo/font_sizes_large/elk/sketch.exp.svg | 1 - .../todo/tall_edge_label/dagre/sketch.exp.svg | 1 - .../todo/tall_edge_label/elk/sketch.exp.svg | 1 - 148 files changed, 43 insertions(+), 162 deletions(-) diff --git a/d2graph/seqdiagram.go b/d2graph/seqdiagram.go index bc40d387b..649756a41 100644 --- a/d2graph/seqdiagram.go +++ b/d2graph/seqdiagram.go @@ -33,7 +33,7 @@ func (obj *Object) IsSequenceDiagramGroup() bool { return false } } - return true + return obj.ContainsAnyObject(obj.Graph.Objects) || obj.ContainsAnyEdge(obj.Graph.Edges) } // notes are descendant of actors with no edges and no children @@ -54,6 +54,28 @@ func (obj *Object) hasEdgeRef() bool { return false } +func (obj *Object) ContainsAnyObject(objects []*Object) bool { + for _, o := range objects { + if o.ContainedBy(obj) { + return true + } + } + return false +} + +func (o *Object) ContainedBy(obj *Object) bool { + for _, ref := range o.References { + curr := ref.UnresolvedScopeObj + for curr != nil { + if curr == obj { + return true + } + curr = curr.Parent + } + } + return false +} + func (obj *Object) ContainsAnyEdge(edges []*Edge) bool { for _, e := range edges { if e.ContainedBy(obj) { diff --git a/d2renderers/d2svg/style.css b/d2renderers/d2svg/style.css index 0068533c5..e07084d0f 100644 --- a/d2renderers/d2svg/style.css +++ b/d2renderers/d2svg/style.css @@ -6,7 +6,6 @@ stroke-linecap: round; stroke-linejoin: round; } - .blend { mix-blend-mode: multiply; } diff --git a/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg b/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg index 1ff7bb178..4e499dd8c 100644 --- a/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg +++ b/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg @@ -12,7 +12,6 @@ width="486" height="552" viewBox="-100 -100 486 552">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json index 49d702816..57883e022 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json @@ -339,7 +339,7 @@ "link": "", "icon": null, "iconPosition": "", - "blend": true, + "blend": false, "fields": null, "methods": null, "columns": null, @@ -418,7 +418,7 @@ "link": "", "icon": null, "iconPosition": "", - "blend": true, + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg index 42148947f..47a70e507 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg @@ -12,13 +12,12 @@ width="1057" height="2268" viewBox="-100 -50 1057 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg index 4d41134f1..f1ab7fd85 100644 --- a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg @@ -12,7 +12,6 @@ width="1593" height="1626" viewBox="-100 -50 1593 1626">abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json index 2bec690f8..494c31964 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json @@ -343,7 +343,7 @@ "link": "", "icon": null, "iconPosition": "", - "blend": true, + "blend": false, "fields": null, "methods": null, "columns": null, diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg index 1a00cde91..d96000897 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg @@ -12,13 +12,12 @@ width="2374" height="2488" viewBox="-88 -88 2374 2488">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg index a80bfc5fa..8e5a98c71 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg @@ -12,7 +12,6 @@ width="666" height="1366" viewBox="-100 -50 666 1366">an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long - - - - - - +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long + + + + + + an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long - - - - - - +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long + + + + + + a labelblabelsa class+ -public() bool -void- -private() int -voidcloudyyyya := 5 +a labelblabelsa class+ +public() bool +void- +private() int +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid -int -name -varchar - result := callThisFunction(obj, 5) midthis sideother side - - - +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +int +name +varchar + result := callThisFunction(obj, 5) midthis sideother side + + + a labelblabelsa class+ -public() bool -void- -private() int -voidcloudyyyya := 5 +a labelblabelsa class+ +public() bool +void- +private() int +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid -int -name -varchar - result := callThisFunction(obj, 5) midthis sideother side - - - +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +int +name +varchar + result := callThisFunction(obj, 5) midthis sideother side + + + abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note - - - - - +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note + + + + + abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note - - - - - +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note + + + + + ba a note here to remember that padding must consider notes toojustalongnotehere \ No newline at end of file diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_long_note/elk/board.exp.json new file mode 100644 index 000000000..2e66a4eb8 --- /dev/null +++ b/e2etests/testdata/stable/sequence_diagram_long_note/elk/board.exp.json @@ -0,0 +1,280 @@ +{ + "name": "", + "shapes": [ + { + "id": "b", + "type": "", + "pos": { + "x": 0, + "y": 50 + }, + "width": 150, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#EDF0FD", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "b", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 13, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + }, + { + "id": "b.note", + "type": "rectangle", + "pos": { + "x": -187, + "y": 436 + }, + "width": 525, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#FFFFFF", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "a note here to remember that padding must consider notes too", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 425, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 5, + "level": 2 + }, + { + "id": "a", + "type": "", + "pos": { + "x": 313, + "y": 50 + }, + "width": 150, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#EDF0FD", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "a", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 12, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + }, + { + "id": "a.note", + "type": "rectangle", + "pos": { + "x": 319, + "y": 692 + }, + "width": 137, + "height": 190, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#FFFFFF", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "just\na\nlong\nnote\nhere", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 37, + "labelHeight": 90, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 5, + "level": 2 + } + ], + "connections": [ + { + "id": "(a -> b)[0]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 388, + "y": 306 + }, + { + "x": 75, + "y": 306 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(b -- )[0]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "b-lifeline-end-668380428", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 176 + }, + { + "x": 75, + "y": 1012 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 2 + }, + { + "id": "(a -- )[0]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "a-lifeline-end-2251863791", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 388, + "y": 176 + }, + { + "x": 388, + "y": 1012 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 2 + } + ] +} diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_long_note/elk/sketch.exp.svg new file mode 100644 index 000000000..d73943b18 --- /dev/null +++ b/e2etests/testdata/stable/sequence_diagram_long_note/elk/sketch.exp.svg @@ -0,0 +1,24 @@ + +ba a note here to remember that padding must consider notes toojustalongnotehere \ No newline at end of file diff --git a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg index f2bb4e085..a35a7be98 100644 --- a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg @@ -2,7 +2,7 @@ abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier + + abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier - - +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier + + How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place - - - - - - - - - - - - - - +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place + + + + + + + + + + + + + + How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place - - - - - - - - - - - - - - +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place + + + + + + + + + + + + + + ab a self edge herebetween actorsto descendantto deeper descendantto parentactor - +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor + - - - - - + + + + + ab a self edge herebetween actorsto descendantto deeper descendantto parentactor - +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor + - - - - - + + + + + AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response - - - - - - - - - +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response + + + + + + + + + AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response - - - - - - - - - +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response + + + + + + + + + scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - - - - - - - - - - - - - +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + + + + + + + + + + + + + a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - - - - - - - - - - - - - +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + + + + + + + + + + + + + bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo \ No newline at end of file diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/elk/board.exp.json b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/elk/board.exp.json new file mode 100644 index 000000000..2a26b1e83 --- /dev/null +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/elk/board.exp.json @@ -0,0 +1,665 @@ +{ + "name": "", + "shapes": [ + { + "id": "b", + "type": "", + "pos": { + "x": 0, + "y": 50 + }, + "width": 150, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#EDF0FD", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "b", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 13, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + }, + { + "id": "a", + "type": "", + "pos": { + "x": 250, + "y": 50 + }, + "width": 150, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#EDF0FD", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "a", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 12, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + }, + { + "id": "c", + "type": "", + "pos": { + "x": 500, + "y": 50 + }, + "width": 150, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#EDF0FD", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "c", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 12, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + }, + { + "id": "this is a message group", + "type": "", + "pos": { + "x": -71, + "y": 396 + }, + "width": 542, + "height": 696, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#EDF0FD", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "this is a message group", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 160, + "labelHeight": 26, + "zIndex": 1, + "level": 1 + }, + { + "id": "this is a message group.and this is a nested message group", + "type": "", + "pos": { + "x": -47, + "y": 526 + }, + "width": 494, + "height": 542, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#FFFFFF", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "and this is a nested message group", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 238, + "labelHeight": 26, + "zIndex": 1, + "level": 2 + }, + { + "id": "this is a message group.and this is a nested message group.what about more nesting", + "type": "", + "pos": { + "x": -23, + "y": 656 + }, + "width": 446, + "height": 388, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#EEF1F8", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "what about more nesting", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 173, + "labelHeight": 26, + "zIndex": 1, + "level": 3 + }, + { + "id": "this is a message group.and this is a nested message group.what about more nesting.yo", + "type": "", + "pos": { + "x": 1, + "y": 786 + }, + "width": 398, + "height": 234, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#FFFFFF", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "yo", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 21, + "labelHeight": 26, + "zIndex": 1, + "level": 4 + }, + { + "id": "this is a message group.and this is a nested message group.what about more nesting.yo.yo", + "type": "", + "pos": { + "x": 25, + "y": 916 + }, + "width": 350, + "height": 80, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#EEF1F8", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "yo", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 21, + "labelHeight": 26, + "zIndex": 1, + "level": 5 + } + ], + "connections": [ + { + "id": "(b -> c)[0]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "c", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 306 + }, + { + "x": 575, + "y": 306 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -> b)[0]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 325, + "y": 436 + }, + { + "x": 75, + "y": 436 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -> b)[1]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 325, + "y": 566 + }, + { + "x": 75, + "y": 566 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -> b)[2]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 325, + "y": 696 + }, + { + "x": 75, + "y": 696 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -> b)[3]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 325, + "y": 826 + }, + { + "x": 75, + "y": 826 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -> b)[4]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 325, + "y": 956 + }, + { + "x": 75, + "y": 956 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(b -- )[0]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "b-lifeline-end-668380428", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 176 + }, + { + "x": 75, + "y": 1086 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 2 + }, + { + "id": "(a -- )[0]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "a-lifeline-end-2251863791", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 325, + "y": 176 + }, + { + "x": 325, + "y": 1086 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 2 + }, + { + "id": "(c -- )[0]", + "src": "c", + "srcArrow": "none", + "srcLabel": "", + "dst": "c-lifeline-end-955173837", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 575, + "y": 176 + }, + { + "x": 575, + "y": 1086 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 2 + } + ] +} diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/elk/sketch.exp.svg b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/elk/sketch.exp.svg new file mode 100644 index 000000000..7663e9dd0 --- /dev/null +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/elk/sketch.exp.svg @@ -0,0 +1,24 @@ + +bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo \ No newline at end of file diff --git a/e2etests/todo_test.go b/e2etests/todo_test.go index a0cecce13..cc15f14ec 100644 --- a/e2etests/todo_test.go +++ b/e2etests/todo_test.go @@ -66,6 +66,29 @@ ninety nine: { } } `, + }, { + // as nesting gets deeper, the groups advance towards `c` and may overlap its lifeline + // needs to consider the group size when computing the distance from `a` to `c` + // a similar effect can be seen for spans + name: "sequence_diagram_actor_padding_nested_groups", + script: `shape: sequence_diagram +b;a;c +b -> c +this is a message group: { + _.a -> _.b + and this is a nested message group: { + _._.a -> _._.b + what about more nesting: { + _._._.a -> _._._.b + yo: { + _._._._.a -> _._._._.b + yo: { + _._._._._.a -> _._._._._.b + } + } + } + } +}`, }, } From 21f531dff9dd6463232044055f17f5866db234b6 Mon Sep 17 00:00:00 2001 From: Gavin Nishizawa Date: Mon, 5 Dec 2022 11:10:45 -0800 Subject: [PATCH 09/29] add darge newline test --- e2etests/regression_test.go | 7 ++++++- 1 file changed, 6 insertions(+), 1 deletion(-) diff --git a/e2etests/regression_test.go b/e2etests/regression_test.go index d2ec37c80..4db509e55 100644 --- a/e2etests/regression_test.go +++ b/e2etests/regression_test.go @@ -5,7 +5,12 @@ import ( ) func testRegression(t *testing.T) { - tcs := []testCase{} + tcs := []testCase{ + { + name: "dagre_id_with_newline", + script: `ninety\nnine`, + }, + } runa(t, tcs) } From 8659af5d576fe5808e90c5e8338bd70daac0ac2b Mon Sep 17 00:00:00 2001 From: Gavin Nishizawa Date: Mon, 5 Dec 2022 11:13:19 -0800 Subject: [PATCH 10/29] fix unmarshalling id with newlines from dagre --- d2layouts/d2dagrelayout/layout.go | 3 +++ 1 file changed, 3 insertions(+) diff --git a/d2layouts/d2dagrelayout/layout.go b/d2layouts/d2dagrelayout/layout.go index 3b6885bf8..c984dc2e2 100644 --- a/d2layouts/d2dagrelayout/layout.go +++ b/d2layouts/d2dagrelayout/layout.go @@ -136,6 +136,9 @@ func Layout(ctx context.Context, g *d2graph.Graph) (err error) { if err := json.Unmarshal([]byte(val.String()), &dn); err != nil { return err } + // ID "ninety\nnine" is set in dagre with backticks: g.setNode(`"ninety\nnine"`, ...) + // but unmarshal converts \n into an actual newline, so we need to replace these to get the AbsID string and lookup the node + dn.ID = strings.ReplaceAll(dn.ID, "\n", "\\n") if debugJS { log.Debug(ctx, "graph", slog.F("json", dn)) } From e83eb998cc2e8f8dd82e7600f3ebc6b254263d45 Mon Sep 17 00:00:00 2001 From: Gavin Nishizawa Date: Mon, 5 Dec 2022 11:13:41 -0800 Subject: [PATCH 11/29] update tests --- .../dagre/board.exp.json | 45 +++++++++++++++++++ .../dagre/sketch.exp.svg | 24 ++++++++++ .../dagre_id_with_newline/elk/board.exp.json | 45 +++++++++++++++++++ .../dagre_id_with_newline/elk/sketch.exp.svg | 24 ++++++++++ 4 files changed, 138 insertions(+) create mode 100644 e2etests/testdata/regression/dagre_id_with_newline/dagre/board.exp.json create mode 100644 e2etests/testdata/regression/dagre_id_with_newline/dagre/sketch.exp.svg create mode 100644 e2etests/testdata/regression/dagre_id_with_newline/elk/board.exp.json create mode 100644 e2etests/testdata/regression/dagre_id_with_newline/elk/sketch.exp.svg diff --git a/e2etests/testdata/regression/dagre_id_with_newline/dagre/board.exp.json b/e2etests/testdata/regression/dagre_id_with_newline/dagre/board.exp.json new file mode 100644 index 000000000..4366386d6 --- /dev/null +++ b/e2etests/testdata/regression/dagre_id_with_newline/dagre/board.exp.json @@ -0,0 +1,45 @@ +{ + "name": "", + "shapes": [ + { + "id": "\"ninety\\nnine\"", + "type": "", + "pos": { + "x": 0, + "y": 0 + }, + "width": 151, + "height": 142, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#F7F8FE", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "ninety\nnine", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": true, + "underline": false, + "labelWidth": 51, + "labelHeight": 42, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + } + ], + "connections": [] +} diff --git a/e2etests/testdata/regression/dagre_id_with_newline/dagre/sketch.exp.svg b/e2etests/testdata/regression/dagre_id_with_newline/dagre/sketch.exp.svg new file mode 100644 index 000000000..c9c9cf7da --- /dev/null +++ b/e2etests/testdata/regression/dagre_id_with_newline/dagre/sketch.exp.svg @@ -0,0 +1,24 @@ + +ninetynine \ No newline at end of file diff --git a/e2etests/testdata/regression/dagre_id_with_newline/elk/board.exp.json b/e2etests/testdata/regression/dagre_id_with_newline/elk/board.exp.json new file mode 100644 index 000000000..560f31355 --- /dev/null +++ b/e2etests/testdata/regression/dagre_id_with_newline/elk/board.exp.json @@ -0,0 +1,45 @@ +{ + "name": "", + "shapes": [ + { + "id": "\"ninety\\nnine\"", + "type": "", + "pos": { + "x": 12, + "y": 12 + }, + "width": 151, + "height": 142, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#F7F8FE", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "ninety\nnine", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": true, + "underline": false, + "labelWidth": 51, + "labelHeight": 42, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + } + ], + "connections": [] +} diff --git a/e2etests/testdata/regression/dagre_id_with_newline/elk/sketch.exp.svg b/e2etests/testdata/regression/dagre_id_with_newline/elk/sketch.exp.svg new file mode 100644 index 000000000..c967c4201 --- /dev/null +++ b/e2etests/testdata/regression/dagre_id_with_newline/elk/sketch.exp.svg @@ -0,0 +1,24 @@ + +ninetynine \ No newline at end of file From 53bceb85786feee6f974ca99b2d78b7132218a87 Mon Sep 17 00:00:00 2001 From: Gavin Nishizawa Date: Mon, 5 Dec 2022 11:40:21 -0800 Subject: [PATCH 12/29] fix dagre layout with \r in IDs --- d2compiler/compile_test.go | 11 +++++++++++ d2layouts/d2dagrelayout/layout.go | 9 +++++++-- e2etests/regression_test.go | 8 ++++++-- 3 files changed, 24 insertions(+), 4 deletions(-) diff --git a/d2compiler/compile_test.go b/d2compiler/compile_test.go index fa5f12f07..0855902f0 100644 --- a/d2compiler/compile_test.go +++ b/d2compiler/compile_test.go @@ -1351,6 +1351,17 @@ y -> x.style b`, g.Objects[0].Attributes.Label.Value) }, }, + { + name: "unescaped_id_cr", + + text: `b\rb`, + assertions: func(t *testing.T, g *d2graph.Graph) { + if len(g.Objects) != 1 { + t.Fatal(g.Objects) + } + assert.String(t, "b\rb", g.Objects[0].Attributes.Label.Value) + }, + }, { name: "class_style", diff --git a/d2layouts/d2dagrelayout/layout.go b/d2layouts/d2dagrelayout/layout.go index c984dc2e2..cd2e44d21 100644 --- a/d2layouts/d2dagrelayout/layout.go +++ b/d2layouts/d2dagrelayout/layout.go @@ -259,15 +259,20 @@ func setGraphAttrs(attrs dagreGraphAttrs) string { ) } +func escapeID(id string) string { + return strings.ReplaceAll(id, "\r", "\\r") +} + func generateAddNodeLine(id string, width, height int) string { + id = escapeID(id) return fmt.Sprintf("g.setNode(`%s`, { id: `%s`, width: %d, height: %d });\n", id, id, width, height) } func generateAddParentLine(childID, parentID string) string { - return fmt.Sprintf("g.setParent(`%s`, `%s`);\n", childID, parentID) + return fmt.Sprintf("g.setParent(`%s`, `%s`);\n", escapeID(childID), escapeID(parentID)) } func generateAddEdgeLine(fromID, toID, edgeID string) string { // in dagre v is from, w is to, name is to uniquely identify - return fmt.Sprintf("g.setEdge({v:`%s`, w:`%s`, name:`%s` });\n", fromID, toID, edgeID) + return fmt.Sprintf("g.setEdge({v:`%s`, w:`%s`, name:`%s` });\n", escapeID(fromID), escapeID(toID), escapeID(edgeID)) } diff --git a/e2etests/regression_test.go b/e2etests/regression_test.go index 4db509e55..fc0f6c7c7 100644 --- a/e2etests/regression_test.go +++ b/e2etests/regression_test.go @@ -7,8 +7,12 @@ import ( func testRegression(t *testing.T) { tcs := []testCase{ { - name: "dagre_id_with_newline", - script: `ninety\nnine`, + name: "dagre_id_with_newline", + script: ` +ninety\nnine +eighty\reight +seventy\r\nseven +`, }, } From a9f0d5978b593e6f7039e54b9b6638c484b9abdc Mon Sep 17 00:00:00 2001 From: Gavin Nishizawa Date: Mon, 5 Dec 2022 11:41:35 -0800 Subject: [PATCH 13/29] update tests --- .../dagre/board.exp.json | 78 ++++++++++++++ .../dagre/sketch.exp.svg | 4 +- .../dagre_id_with_newline/elk/board.exp.json | 80 +++++++++++++- .../dagre_id_with_newline/elk/sketch.exp.svg | 4 +- .../TestCompile/unescaped_id_cr.exp.json | 102 ++++++++++++++++++ 5 files changed, 263 insertions(+), 5 deletions(-) create mode 100644 testdata/d2compiler/TestCompile/unescaped_id_cr.exp.json diff --git a/e2etests/testdata/regression/dagre_id_with_newline/dagre/board.exp.json b/e2etests/testdata/regression/dagre_id_with_newline/dagre/board.exp.json index 4366386d6..be2cc9969 100644 --- a/e2etests/testdata/regression/dagre_id_with_newline/dagre/board.exp.json +++ b/e2etests/testdata/regression/dagre_id_with_newline/dagre/board.exp.json @@ -39,6 +39,84 @@ "labelPosition": "INSIDE_MIDDLE_CENTER", "zIndex": 0, "level": 1 + }, + { + "id": "eighty\reight", + "type": "", + "pos": { + "x": 211, + "y": 8 + }, + "width": 151, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#F7F8FE", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "eighty\reight", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": true, + "underline": false, + "labelWidth": 51, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + }, + { + "id": "\"seventy\r\\nseven\"", + "type": "", + "pos": { + "x": 422, + "y": 0 + }, + "width": 162, + "height": 142, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#F7F8FE", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "fields": null, + "methods": null, + "columns": null, + "label": "seventy\r\nseven", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": true, + "underline": false, + "labelWidth": 62, + "labelHeight": 42, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 } ], "connections": [] diff --git a/e2etests/testdata/regression/dagre_id_with_newline/dagre/sketch.exp.svg b/e2etests/testdata/regression/dagre_id_with_newline/dagre/sketch.exp.svg index c9c9cf7da..eeb82e050 100644 --- a/e2etests/testdata/regression/dagre_id_with_newline/dagre/sketch.exp.svg +++ b/e2etests/testdata/regression/dagre_id_with_newline/dagre/sketch.exp.svg @@ -2,7 +2,7 @@ -rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/investigate/elk/board.exp.json b/e2etests/testdata/stable/investigate/elk/board.exp.json index 19c07f20c..6e983b96d 100644 --- a/e2etests/testdata/stable/investigate/elk/board.exp.json +++ b/e2etests/testdata/stable/investigate/elk/board.exp.json @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F0F3F9", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -545,7 +545,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F0F3F9", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg index df2c32fbb..6655cd820 100644 --- a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg @@ -14,10 +14,11 @@ width="860" height="4868" viewBox="-82 -88 860 4868">aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg index bc6ebed4a..13eab90b5 100644 --- a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg @@ -14,6 +14,7 @@ width="3244" height="1780" viewBox="-100 -100 3244 1780">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json index 57883e022..c0dc10419 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json @@ -172,9 +172,9 @@ "height": 80, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -211,9 +211,9 @@ "height": 730, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,9 +250,9 @@ "height": 80, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -289,9 +289,9 @@ "height": 466, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -368,9 +368,9 @@ "height": 216, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg index 47a70e507..68c5e9b9c 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg @@ -14,10 +14,11 @@ width="1057" height="2268" viewBox="-100 -50 1057 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_nested_groups/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_nested_groups/dagre/board.exp.json new file mode 100644 index 000000000..8186c7b98 --- /dev/null +++ b/e2etests/testdata/stable/sequence_diagram_nested_groups/dagre/board.exp.json @@ -0,0 +1,1105 @@ +{ + "name": "", + "shapes": [ + { + "id": "this is a message group", + "type": "", + "pos": { + "x": -121, + "y": 266 + }, + "width": 562, + "height": 952, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "this is a message group", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 160, + "labelHeight": 26, + "zIndex": 3, + "level": 1 + }, + { + "id": "this is a message group.and this is a nested message group", + "type": "", + "pos": { + "x": -97, + "y": 396 + }, + "width": 514, + "height": 798, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "and this is a nested message group", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 238, + "labelHeight": 26, + "zIndex": 3, + "level": 2 + }, + { + "id": "this is a message group.and this is a nested message group.what about more nesting", + "type": "", + "pos": { + "x": -73, + "y": 526 + }, + "width": 466, + "height": 644, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "what about more nesting", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 173, + "labelHeight": 26, + "zIndex": 3, + "level": 3 + }, + { + "id": "this is a message group.and this is a nested message group.what about more nesting.crazy town", + "type": "", + "pos": { + "x": -49, + "y": 656 + }, + "width": 418, + "height": 490, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "crazy town", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 77, + "labelHeight": 26, + "zIndex": 3, + "level": 4 + }, + { + "id": "a", + "type": "", + "pos": { + "x": 0, + "y": 50 + }, + "width": 150, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#EDF0FD", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "a", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 12, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + }, + { + "id": "a.a note", + "type": "rectangle", + "pos": { + "x": 1, + "y": 696 + }, + "width": 148, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#FFFFFF", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "a note", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 48, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 5, + "level": 2 + }, + { + "id": "this is a message group.and this is a nested message group.what about more nesting.crazy town.whoa", + "type": "", + "pos": { + "x": 25, + "y": 1042 + }, + "width": 320, + "height": 80, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "whoa", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 41, + "labelHeight": 26, + "zIndex": 3, + "level": 5 + }, + { + "id": "alt", + "type": "", + "pos": { + "x": 221, + "y": 1148 + }, + "width": 388, + "height": 518, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "alt", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 24, + "labelHeight": 26, + "zIndex": 3, + "level": 1 + }, + { + "id": "alt.case 1", + "type": "", + "pos": { + "x": 245, + "y": 1172 + }, + "width": 340, + "height": 80, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "case 1", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 47, + "labelHeight": 26, + "zIndex": 3, + "level": 2 + }, + { + "id": "alt.case 2", + "type": "", + "pos": { + "x": 245, + "y": 1302 + }, + "width": 340, + "height": 80, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "case 2", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 47, + "labelHeight": 26, + "zIndex": 3, + "level": 2 + }, + { + "id": "alt.case 3", + "type": "", + "pos": { + "x": 245, + "y": 1432 + }, + "width": 340, + "height": 80, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "case 3", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 47, + "labelHeight": 26, + "zIndex": 3, + "level": 2 + }, + { + "id": "alt.case 4", + "type": "", + "pos": { + "x": 245, + "y": 1562 + }, + "width": 340, + "height": 80, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "case 4", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 47, + "labelHeight": 26, + "zIndex": 3, + "level": 2 + }, + { + "id": "b", + "type": "", + "pos": { + "x": 220, + "y": 50 + }, + "width": 150, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#EDF0FD", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "b", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 13, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + }, + { + "id": "b.note", + "type": "rectangle", + "pos": { + "x": 32, + "y": 2052 + }, + "width": 525, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#FFFFFF", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "a note here to remember that padding must consider notes too", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 425, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 5, + "level": 2 + }, + { + "id": "a.note", + "type": "rectangle", + "pos": { + "x": 6, + "y": 1732 + }, + "width": 137, + "height": 190, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#FFFFFF", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "just\na\nlong\nnote\nhere", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 37, + "labelHeight": 90, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 5, + "level": 2 + }, + { + "id": "c", + "type": "", + "pos": { + "x": 440, + "y": 50 + }, + "width": 190, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#EDF0FD", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "just an actor", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 90, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + } + ], + "connections": [ + { + "id": "(a -> b)[0]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 306 + }, + { + "x": 295, + "y": 306 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -> b)[1]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 436 + }, + { + "x": 295, + "y": 436 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -> b)[2]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 566 + }, + { + "x": 295, + "y": 566 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -> b)[3]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 952 + }, + { + "x": 295, + "y": 952 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -> b)[4]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 1082 + }, + { + "x": 295, + "y": 1082 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(b -> c)[0]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "c", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 295, + "y": 1212 + }, + { + "x": 535, + "y": 1212 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(b -> c)[1]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "c", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 295, + "y": 1342 + }, + { + "x": 535, + "y": 1342 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(b -> c)[2]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "c", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 295, + "y": 1472 + }, + { + "x": 535, + "y": 1472 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(b -> c)[3]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "c", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 295, + "y": 1602 + }, + { + "x": 535, + "y": 1602 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -- )[0]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "a-lifeline-end-2251863791", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 176 + }, + { + "x": 75, + "y": 2308 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 1 + }, + { + "id": "(b -- )[0]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "b-lifeline-end-668380428", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 295, + "y": 176 + }, + { + "x": 295, + "y": 2308 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 1 + }, + { + "id": "(c -- )[0]", + "src": "c", + "srcArrow": "none", + "srcLabel": "", + "dst": "c-lifeline-end-955173837", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 535, + "y": 176 + }, + { + "x": 535, + "y": 2308 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 1 + } + ] +} diff --git a/e2etests/testdata/stable/sequence_diagram_nested_groups/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_nested_groups/dagre/sketch.exp.svg new file mode 100644 index 000000000..0a12d265e --- /dev/null +++ b/e2etests/testdata/stable/sequence_diagram_nested_groups/dagre/sketch.exp.svg @@ -0,0 +1,28 @@ + +abjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehere \ No newline at end of file diff --git a/e2etests/testdata/stable/sequence_diagram_nested_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_nested_groups/elk/board.exp.json new file mode 100644 index 000000000..8186c7b98 --- /dev/null +++ b/e2etests/testdata/stable/sequence_diagram_nested_groups/elk/board.exp.json @@ -0,0 +1,1105 @@ +{ + "name": "", + "shapes": [ + { + "id": "this is a message group", + "type": "", + "pos": { + "x": -121, + "y": 266 + }, + "width": 562, + "height": 952, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "this is a message group", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 160, + "labelHeight": 26, + "zIndex": 3, + "level": 1 + }, + { + "id": "this is a message group.and this is a nested message group", + "type": "", + "pos": { + "x": -97, + "y": 396 + }, + "width": 514, + "height": 798, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "and this is a nested message group", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 238, + "labelHeight": 26, + "zIndex": 3, + "level": 2 + }, + { + "id": "this is a message group.and this is a nested message group.what about more nesting", + "type": "", + "pos": { + "x": -73, + "y": 526 + }, + "width": 466, + "height": 644, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "what about more nesting", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 173, + "labelHeight": 26, + "zIndex": 3, + "level": 3 + }, + { + "id": "this is a message group.and this is a nested message group.what about more nesting.crazy town", + "type": "", + "pos": { + "x": -49, + "y": 656 + }, + "width": 418, + "height": 490, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "crazy town", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 77, + "labelHeight": 26, + "zIndex": 3, + "level": 4 + }, + { + "id": "a", + "type": "", + "pos": { + "x": 0, + "y": 50 + }, + "width": 150, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#EDF0FD", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "a", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 12, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + }, + { + "id": "a.a note", + "type": "rectangle", + "pos": { + "x": 1, + "y": 696 + }, + "width": 148, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#FFFFFF", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "a note", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 48, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 5, + "level": 2 + }, + { + "id": "this is a message group.and this is a nested message group.what about more nesting.crazy town.whoa", + "type": "", + "pos": { + "x": 25, + "y": 1042 + }, + "width": 320, + "height": 80, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "whoa", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 41, + "labelHeight": 26, + "zIndex": 3, + "level": 5 + }, + { + "id": "alt", + "type": "", + "pos": { + "x": 221, + "y": 1148 + }, + "width": 388, + "height": 518, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "alt", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 24, + "labelHeight": 26, + "zIndex": 3, + "level": 1 + }, + { + "id": "alt.case 1", + "type": "", + "pos": { + "x": 245, + "y": 1172 + }, + "width": 340, + "height": 80, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "case 1", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 47, + "labelHeight": 26, + "zIndex": 3, + "level": 2 + }, + { + "id": "alt.case 2", + "type": "", + "pos": { + "x": 245, + "y": 1302 + }, + "width": 340, + "height": 80, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "case 2", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 47, + "labelHeight": 26, + "zIndex": 3, + "level": 2 + }, + { + "id": "alt.case 3", + "type": "", + "pos": { + "x": 245, + "y": 1432 + }, + "width": 340, + "height": 80, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "case 3", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 47, + "labelHeight": 26, + "zIndex": 3, + "level": 2 + }, + { + "id": "alt.case 4", + "type": "", + "pos": { + "x": 245, + "y": 1562 + }, + "width": 340, + "height": 80, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#DEE1EB", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": true, + "fields": null, + "methods": null, + "columns": null, + "label": "case 4", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 47, + "labelHeight": 26, + "zIndex": 3, + "level": 2 + }, + { + "id": "b", + "type": "", + "pos": { + "x": 220, + "y": 50 + }, + "width": 150, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#EDF0FD", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "b", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 13, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + }, + { + "id": "b.note", + "type": "rectangle", + "pos": { + "x": 32, + "y": 2052 + }, + "width": 525, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#FFFFFF", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "a note here to remember that padding must consider notes too", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 425, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 5, + "level": 2 + }, + { + "id": "a.note", + "type": "rectangle", + "pos": { + "x": 6, + "y": 1732 + }, + "width": 137, + "height": 190, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#FFFFFF", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "just\na\nlong\nnote\nhere", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 37, + "labelHeight": 90, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 5, + "level": 2 + }, + { + "id": "c", + "type": "", + "pos": { + "x": 440, + "y": 50 + }, + "width": 190, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "borderRadius": 0, + "fill": "#EDF0FD", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "just an actor", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": false, + "underline": false, + "labelWidth": 90, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + } + ], + "connections": [ + { + "id": "(a -> b)[0]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 306 + }, + { + "x": 295, + "y": 306 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -> b)[1]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 436 + }, + { + "x": 295, + "y": 436 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -> b)[2]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 566 + }, + { + "x": 295, + "y": 566 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -> b)[3]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 952 + }, + { + "x": 295, + "y": 952 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -> b)[4]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "b", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 1082 + }, + { + "x": 295, + "y": 1082 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(b -> c)[0]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "c", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 295, + "y": 1212 + }, + { + "x": 535, + "y": 1212 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(b -> c)[1]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "c", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 295, + "y": 1342 + }, + { + "x": 535, + "y": 1342 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(b -> c)[2]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "c", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 295, + "y": 1472 + }, + { + "x": 535, + "y": 1472 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(b -> c)[3]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "c", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 295, + "y": 1602 + }, + { + "x": 535, + "y": 1602 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 4 + }, + { + "id": "(a -- )[0]", + "src": "a", + "srcArrow": "none", + "srcLabel": "", + "dst": "a-lifeline-end-2251863791", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 75, + "y": 176 + }, + { + "x": 75, + "y": 2308 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 1 + }, + { + "id": "(b -- )[0]", + "src": "b", + "srcArrow": "none", + "srcLabel": "", + "dst": "b-lifeline-end-668380428", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 295, + "y": 176 + }, + { + "x": 295, + "y": 2308 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 1 + }, + { + "id": "(c -- )[0]", + "src": "c", + "srcArrow": "none", + "srcLabel": "", + "dst": "c-lifeline-end-955173837", + "dstArrow": "none", + "dstLabel": "", + "opacity": 1, + "strokeDash": 6, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 535, + "y": 176 + }, + { + "x": 535, + "y": 2308 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 1 + } + ] +} diff --git a/e2etests/testdata/stable/sequence_diagram_nested_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_nested_groups/elk/sketch.exp.svg new file mode 100644 index 000000000..0a12d265e --- /dev/null +++ b/e2etests/testdata/stable/sequence_diagram_nested_groups/elk/sketch.exp.svg @@ -0,0 +1,28 @@ + +abjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehere \ No newline at end of file diff --git a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg index f1ab7fd85..4803655fb 100644 --- a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg @@ -14,6 +14,7 @@ width="1593" height="1626" viewBox="-100 -50 1593 1626">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json index 494c31964..148259e77 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json @@ -372,9 +372,9 @@ "height": 80, "opacity": 1, "strokeDash": 0, - "strokeWidth": 2, + "strokeWidth": 0, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg index d96000897..4c804cb4f 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg @@ -14,10 +14,11 @@ width="2374" height="2488" viewBox="-88 -88 2374 2488">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg index 8e5a98c71..1847369d9 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg @@ -14,6 +14,7 @@ width="666" height="1366" viewBox="-100 -50 666 1366">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json index 005c6a567..ba95b1738 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F0F3F9", + "fill": "#DEE1EB", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg index 3228476ef..f9bc2aef5 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg @@ -14,10 +14,11 @@ width="3166" height="4293" viewBox="-88 -88 3166 4293">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sql_tables/dagre/sketch.exp.svg b/e2etests/testdata/stable/sql_tables/dagre/sketch.exp.svg index 421a07a1a..cf84dfc73 100644 --- a/e2etests/testdata/stable/sql_tables/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sql_tables/dagre/sketch.exp.svg @@ -14,6 +14,7 @@ width="1162" height="660" viewBox="-100 -100 1162 660">abjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnoteherean actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long - - - - - + + + + + an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long - - - - - + + + + + a labelblabelsa class+ -public() bool -void- -private() int -voidcloudyyyya := 5 +a labelblabelsa class+ +public() bool +void- +private() int +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid -int -name -varchar - result := callThisFunction(obj, 5) midthis sideother side +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +int +name +varchar + result := callThisFunction(obj, 5) midthis sideother side - - + + a labelblabelsa class+ -public() bool -void- -private() int -voidcloudyyyya := 5 +a labelblabelsa class+ +public() bool +void- +private() int +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid -int -name -varchar - result := callThisFunction(obj, 5) midthis sideother side +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +int +name +varchar + result := callThisFunction(obj, 5) midthis sideother side - - + + abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note - - - - - +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note + + + + + abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note - - - - - +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note + + + + + ba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnoteherescoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier - + abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier - + How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place - - - - - - - - - - - - - - +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place + + + + + + + + + + + + + + How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place - - - - - - - - - - - - - - +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place + + + + + + + + + + + + + + ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor - - - - - - + + + + + + ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor - - - - - - + + + + + + AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response - - - - - - - - + + + + + + + + AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response - - - - - - - - + + + + + + + + scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - + + + + + + + + + + + + scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - + + + + + + + + + + + + a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - - - - - - - - - - - - - +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + + + + + + + + + + + + + a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) - - - - - - - - - - - - - - - - - - - - - - - - - +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) + + + + + + + + + + + + + + + + + + + + + + + + + bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note - +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note + diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json index 42ec43bf8..00aca25ac 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json @@ -165,8 +165,8 @@ "id": "ggg", "type": "", "pos": { - "x": 25, - "y": 396 + "x": 49, + "y": 420 }, "width": 350, "height": 80, @@ -204,8 +204,8 @@ "id": "group 1", "type": "", "pos": { - "x": 251, - "y": 526 + "x": 275, + "y": 550 }, "width": 398, "height": 730, @@ -243,8 +243,8 @@ "id": "group 1.nested guy", "type": "", "pos": { - "x": 275, - "y": 786 + "x": 299, + "y": 810 }, "width": 350, "height": 80, @@ -282,8 +282,8 @@ "id": "group b", "type": "", "pos": { - "x": 275, - "y": 1306 + "x": 299, + "y": 1330 }, "width": 468, "height": 466, @@ -321,8 +321,8 @@ "id": "c.what would arnold say", "type": "rectangle", "pos": { - "x": 446, - "y": 1476 + "x": 470, + "y": 1500 }, "width": 257, "height": 126, @@ -361,8 +361,8 @@ "id": "choo", "type": "", "pos": { - "x": 693, - "y": 1822 + "x": 717, + "y": 1846 }, "width": 254, "height": 216, @@ -400,8 +400,8 @@ "id": "d.this note", "type": "rectangle", "pos": { - "x": 743, - "y": 1862 + "x": 767, + "y": 1886 }, "width": 164, "height": 126, diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg index 0016febae..baad6e566 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg @@ -2,7 +2,7 @@ abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note + diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json index c88a71bf9..d423c7d1d 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json @@ -45,8 +45,8 @@ "id": "b.note", "type": "rectangle", "pos": { - "x": -187, - "y": 436 + "x": -163, + "y": 460 }, "width": 525, "height": 126, @@ -125,8 +125,8 @@ "id": "a.note", "type": "rectangle", "pos": { - "x": 319, - "y": 692 + "x": 343, + "y": 716 }, "width": 137, "height": 190, diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg index d745a335b..e341c6b43 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg @@ -2,7 +2,7 @@ abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json index e4d793745..39b144a5b 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json @@ -325,8 +325,8 @@ "id": "How this is rendered.d2compiler.measurements also take place", "type": "rectangle", "pos": { - "x": 421, - "y": 732 + "x": 457, + "y": 768 }, "width": 307, "height": 126, @@ -365,8 +365,8 @@ "id": "How this is rendered.only if root is not sequence", "type": "", "pos": { - "x": 781, - "y": 1338 + "x": 817, + "y": 1374 }, "width": 1365, "height": 80, diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg index ad5662304..f2f4d06d7 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2447" height="2536" viewBox="-88 -88 2447 2536">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json index 1c9c641a1..bf9dc2e70 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json @@ -125,8 +125,8 @@ "id": "this is a message group", "type": "", "pos": { - "x": -71, - "y": 396 + "x": -47, + "y": 420 }, "width": 542, "height": 696, @@ -164,8 +164,8 @@ "id": "this is a message group.and this is a nested message group", "type": "", "pos": { - "x": -47, - "y": 526 + "x": -23, + "y": 550 }, "width": 494, "height": 542, @@ -203,8 +203,8 @@ "id": "this is a message group.and this is a nested message group.what about more nesting", "type": "", "pos": { - "x": -23, - "y": 656 + "x": 1, + "y": 680 }, "width": 446, "height": 388, @@ -242,8 +242,8 @@ "id": "this is a message group.and this is a nested message group.what about more nesting.yo", "type": "", "pos": { - "x": 1, - "y": 786 + "x": 25, + "y": 810 }, "width": 398, "height": 234, @@ -281,8 +281,8 @@ "id": "this is a message group.and this is a nested message group.what about more nesting.yo.yo", "type": "", "pos": { - "x": 25, - "y": 916 + "x": 49, + "y": 940 }, "width": 350, "height": 80, diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg index c17ac7f6f..45f3f9430 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg @@ -2,7 +2,7 @@ ab hello ab hello +ab hello rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud cba * cba * ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* abcdefghijklmno abcdefghijklmno aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos1/elk/board.exp.json b/e2etests/testdata/stable/chaos1/elk/board.exp.json index d7fcac07d..8372dc96c 100644 --- a/e2etests/testdata/stable/chaos1/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos1/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg index 62b3bffda..3579dbca5 100644 --- a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="630" height="869" viewBox="-88 -88 630 869">aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos2/dagre/board.exp.json b/e2etests/testdata/stable/chaos2/dagre/board.exp.json index c928b6a24..508c2ef0a 100644 --- a/e2etests/testdata/stable/chaos2/dagre/board.exp.json +++ b/e2etests/testdata/stable/chaos2/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg index 06d891441..4b58359f7 100644 --- a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg @@ -774,8 +774,8 @@ width="1317" height="1854" viewBox="-100 -100 1317 1854">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/chaos2/elk/board.exp.json b/e2etests/testdata/stable/chaos2/elk/board.exp.json index 1aa503f04..31a4ce86a 100644 --- a/e2etests/testdata/stable/chaos2/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos2/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg index 174d4500f..d44e03424 100644 --- a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg @@ -774,8 +774,8 @@ width="1092" height="1907" viewBox="-88 -88 1092 1907">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json index 0ba6c70e2..00b6ab18a 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg index 89f73af80..712788c3f 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="724" height="626" viewBox="-100 -100 724 626">abcd abcd abcd abcd abc abc abc abc acfbdhg acfbdhg acfbdhg acfbdhg agdfbhec agdfbhec agdfbhec agdfbhec abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot bacde21345abcde bacde21345abcde bacde21345abcde bacde21345abcde alphabeta gamma +alphabeta gamma alphabeta gamma +alphabeta gamma size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/font_sizes/elk/board.exp.json b/e2etests/testdata/stable/font_sizes/elk/board.exp.json index 2d5446e61..fbbabd15f 100644 --- a/e2etests/testdata/stable/font_sizes/elk/board.exp.json +++ b/e2etests/testdata/stable/font_sizes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg index 02055f08d..c9d42780f 100644 --- a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1965" height="793" viewBox="-88 -88 1965 793">size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json index 62256201b..297460a3b 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json @@ -53,7 +53,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg index 91b32cb2e..8ed8fda49 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg @@ -1031,7 +1031,7 @@ title for the link, surrounded in quotes. For example:

Code

Unlike a pre-formatted code block, a code span indicates code within a normal paragraph. For example:

-
ab hellohellohellohelloaabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/investigate/elk/board.exp.json b/e2etests/testdata/stable/investigate/elk/board.exp.json index 6e983b96d..70aece788 100644 --- a/e2etests/testdata/stable/investigate/elk/board.exp.json +++ b/e2etests/testdata/stable/investigate/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -505,7 +505,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -836,7 +836,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -876,7 +876,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -916,7 +916,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -996,7 +996,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1036,7 +1036,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1076,7 +1076,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1116,7 +1116,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1156,7 +1156,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1196,7 +1196,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1236,7 +1236,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg index 6655cd820..59d90964e 100644 --- a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="860" height="4868" viewBox="-82 -88 860 4868">aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/large_arch/dagre/board.exp.json b/e2etests/testdata/stable/large_arch/dagre/board.exp.json index f62e8f5a5..c81e7d197 100644 --- a/e2etests/testdata/stable/large_arch/dagre/board.exp.json +++ b/e2etests/testdata/stable/large_arch/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -574,7 +574,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -614,7 +614,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -654,7 +654,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -694,7 +694,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -734,7 +734,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -774,7 +774,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -814,7 +814,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -894,7 +894,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -934,7 +934,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -974,7 +974,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1014,7 +1014,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1054,7 +1054,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1094,7 +1094,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1134,7 +1134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1174,7 +1174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1214,7 +1214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1254,7 +1254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1294,7 +1294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg index 13eab90b5..f3886ef15 100644 --- a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3244" height="1780" viewBox="-100 -100 3244 1780">abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv mixed togethersugarsolution we get +mixed togethersugarsolution we get mixed togethersugarsolution we get +mixed togethersugarsolution we get

Markdown: Syntax

-
ab

Markdown: Syntax

-
ab markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

code

-
ab

code

-
ab thisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesabcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu Foo Baz12hello Foo Baz12hello Foo Baz12hello Foo Baz12hello acdefgbh acdefgbh acdefgbh acdefgbh topabcbottomstartend topabcbottomstartend topabcbottomstartend topabcbottomstartend xyz hello +xyz hello xyz hello +xyz hello an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json index 2341f4127..55a1eec78 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -527,7 +527,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -566,7 +566,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -605,7 +605,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -644,7 +644,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -683,7 +683,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg index 0e9876acc..a46f8c90c 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2692" height="1396" viewBox="-76 -26 2692 1396">an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json index 9f037376a..a32ed6952 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg index b6bd742f3..79f25a284 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json index 9f037376a..a32ed6952 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg index b6bd742f3..79f25a284 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json index 00aca25ac..d6847cc42 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg index baad6e566..9688e4378 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json index 00aca25ac..d6847cc42 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg index baad6e566..9688e4378 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json index d423c7d1d..904780096 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -213,7 +213,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -252,7 +252,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg index e341c6b43..7e9cb62f6 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="850" height="1162" viewBox="-263 -26 850 1162">ba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnoteherescoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json index 39b144a5b..a51050906 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -413,7 +413,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -532,7 +532,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1078,7 +1078,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1117,7 +1117,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1156,7 +1156,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1195,7 +1195,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1234,7 +1234,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1273,7 +1273,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1312,7 +1312,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1351,7 +1351,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1390,7 +1390,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg index f2f4d06d7..b50e4e1a0 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2447" height="2536" viewBox="-88 -88 2447 2536">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json index 76f3e5d4d..a98679802 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -211,7 +211,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg index 72424b802..a415d747a 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json index 76f3e5d4d..a98679802 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -211,7 +211,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg index 72424b802..a415d747a 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json index 1ceb33052..24a642b5f 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg index 14dc4497b..ea3486ab6 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json index 1ceb33052..24a642b5f 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg index 14dc4497b..ea3486ab6 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json index 85ae8a91f..50fdefffc 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -330,7 +330,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg index cb113b131..c61f0cb1b 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json index 85ae8a91f..50fdefffc 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -330,7 +330,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg index cb113b131..c61f0cb1b 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json index b054cf783..cbdb7a97f 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -810,7 +810,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1479,7 +1479,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1950,7 +1950,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2028,7 +2028,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2145,7 +2145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2301,7 +2301,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4161,7 +4161,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4200,7 +4200,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4239,7 +4239,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4278,7 +4278,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4317,7 +4317,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4356,7 +4356,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4395,7 +4395,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4434,7 +4434,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4473,7 +4473,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4512,7 +4512,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4551,7 +4551,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4590,7 +4590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4629,7 +4629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4668,7 +4668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4707,7 +4707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4746,7 +4746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4785,7 +4785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4824,7 +4824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg index 468339af5..eb0b93c75 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3402" height="4269" viewBox="-100 -100 3402 4269">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json index 030b0be63..ed74bde39 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -810,7 +810,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1479,7 +1479,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1950,7 +1950,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2028,7 +2028,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2145,7 +2145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2301,7 +2301,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4080,7 +4080,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4119,7 +4119,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4158,7 +4158,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4197,7 +4197,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4236,7 +4236,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4275,7 +4275,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4314,7 +4314,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4353,7 +4353,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4392,7 +4392,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4431,7 +4431,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4470,7 +4470,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4509,7 +4509,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4548,7 +4548,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4587,7 +4587,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4626,7 +4626,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4665,7 +4665,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4704,7 +4704,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4743,7 +4743,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg index c76a1e7eb..98eabe978 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="3324" height="4389" viewBox="-88 -88 3324 4389">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/square_3d/dagre/board.exp.json b/e2etests/testdata/stable/square_3d/dagre/board.exp.json index 8a037500b..961981fc6 100644 --- a/e2etests/testdata/stable/square_3d/dagre/board.exp.json +++ b/e2etests/testdata/stable/square_3d/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": true, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": true, diff --git a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg index 834d15ac7..536b963fa 100644 --- a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg @@ -20,9 +20,9 @@ width="371" height="580" viewBox="-100 -100 371 580"> -rectangle +rectangle -square -rectangle +rectangle -square acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc AKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDcontainerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json index 35b0e5dd0..f55ea2ba1 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json +++ b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg index df3ac9c7a..a80b6ae79 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="536" height="663" viewBox="-88 -88 536 663">containerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json index f3951de5d..3dddb42bd 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#A6B8F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg index bf4b4f2b7..6a50fec38 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="664" height="716" viewBox="-100 -100 664 716">ninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneighteightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json index d012e76be..54a4ee87e 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg index c417a43f7..1b1f29ab4 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="789" height="2014" viewBox="-39 -88 789 2014">eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json index bf9dc2e70..4cf3eda9b 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -563,7 +563,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -602,7 +602,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -641,7 +641,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#234CDA", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg index 45f3f9430..96cc12cb0 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="921" height="1242" viewBox="-147 -26 921 1242">bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel abc abc abc abc ab ab ab ab acbd acbd acbd acbd ab hello +ab hello ab hello +ab hello rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud cba * cba * cba * cba * ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* abcdefghijklmno abcdefghijklmno abcdefghijklmno abcdefghijklmno aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos1/elk/board.exp.json b/e2etests/testdata/stable/chaos1/elk/board.exp.json index 8372dc96c..d7fcac07d 100644 --- a/e2etests/testdata/stable/chaos1/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos1/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg index 3579dbca5..62b3bffda 100644 --- a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="630" height="869" viewBox="-88 -88 630 869">aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos2/dagre/board.exp.json b/e2etests/testdata/stable/chaos2/dagre/board.exp.json index 508c2ef0a..c928b6a24 100644 --- a/e2etests/testdata/stable/chaos2/dagre/board.exp.json +++ b/e2etests/testdata/stable/chaos2/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg index 4b58359f7..06d891441 100644 --- a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg @@ -774,8 +774,8 @@ width="1317" height="1854" viewBox="-100 -100 1317 1854">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/chaos2/elk/board.exp.json b/e2etests/testdata/stable/chaos2/elk/board.exp.json index 31a4ce86a..1aa503f04 100644 --- a/e2etests/testdata/stable/chaos2/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos2/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg index d44e03424..174d4500f 100644 --- a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg @@ -774,8 +774,8 @@ width="1092" height="1907" viewBox="-88 -88 1092 1907">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json index 00b6ab18a..0ba6c70e2 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg index 712788c3f..89f73af80 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="724" height="626" viewBox="-100 -100 724 626">abcd abcd abcd abcd abc abc abc abc acfbdhg acfbdhg acfbdhg acfbdhg agdfbhec agdfbhec agdfbhec agdfbhec abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot bacde21345abcde bacde21345abcde bacde21345abcde bacde21345abcde alphabeta gamma +alphabeta gamma alphabeta gamma +alphabeta gamma size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/font_sizes/elk/board.exp.json b/e2etests/testdata/stable/font_sizes/elk/board.exp.json index fbbabd15f..2d5446e61 100644 --- a/e2etests/testdata/stable/font_sizes/elk/board.exp.json +++ b/e2etests/testdata/stable/font_sizes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg index c9d42780f..02055f08d 100644 --- a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1965" height="793" viewBox="-88 -88 1965 793">size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json index 297460a3b..62256201b 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json @@ -53,7 +53,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg index 8ed8fda49..91b32cb2e 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg @@ -1031,7 +1031,7 @@ title for the link, surrounded in quotes. For example:

Code

Unlike a pre-formatted code block, a code span indicates code within a normal paragraph. For example:

-
ab hellohellohellohelloaabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/investigate/elk/board.exp.json b/e2etests/testdata/stable/investigate/elk/board.exp.json index 70aece788..6e983b96d 100644 --- a/e2etests/testdata/stable/investigate/elk/board.exp.json +++ b/e2etests/testdata/stable/investigate/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -505,7 +505,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -836,7 +836,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -876,7 +876,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -916,7 +916,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -996,7 +996,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1036,7 +1036,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1076,7 +1076,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1116,7 +1116,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1156,7 +1156,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1196,7 +1196,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1236,7 +1236,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg index 59d90964e..6655cd820 100644 --- a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="860" height="4868" viewBox="-82 -88 860 4868">aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/large_arch/dagre/board.exp.json b/e2etests/testdata/stable/large_arch/dagre/board.exp.json index c81e7d197..f62e8f5a5 100644 --- a/e2etests/testdata/stable/large_arch/dagre/board.exp.json +++ b/e2etests/testdata/stable/large_arch/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -574,7 +574,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -614,7 +614,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -654,7 +654,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -694,7 +694,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -734,7 +734,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -774,7 +774,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -814,7 +814,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -894,7 +894,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -934,7 +934,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -974,7 +974,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1014,7 +1014,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1054,7 +1054,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1094,7 +1094,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1134,7 +1134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1174,7 +1174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1214,7 +1214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1254,7 +1254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1294,7 +1294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg index f3886ef15..13eab90b5 100644 --- a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3244" height="1780" viewBox="-100 -100 3244 1780">abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv mixed togethersugarsolution we get +mixed togethersugarsolution we get mixed togethersugarsolution we get +mixed togethersugarsolution we get

Markdown: Syntax

-
ab

Markdown: Syntax

-
ab markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

code

-
ab

code

-
ab thisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesabcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu Foo Baz12hello Foo Baz12hello Foo Baz12hello Foo Baz12hello acdefgbh acdefgbh acdefgbh acdefgbh topabcbottomstartend topabcbottomstartend topabcbottomstartend topabcbottomstartend xyz hello +xyz hello xyz hello +xyz hello an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json index 55a1eec78..2341f4127 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -527,7 +527,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -566,7 +566,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -605,7 +605,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -644,7 +644,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -683,7 +683,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg index a46f8c90c..0e9876acc 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2692" height="1396" viewBox="-76 -26 2692 1396">an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json index a32ed6952..9f037376a 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg index 79f25a284..b6bd742f3 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json index a32ed6952..9f037376a 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg index 79f25a284..b6bd742f3 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json index d6847cc42..bf7d446c6 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg index 9688e4378..225993ad1 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json index d6847cc42..bf7d446c6 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg index 9688e4378..225993ad1 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json index 904780096..d423c7d1d 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -213,7 +213,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -252,7 +252,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg index 7e9cb62f6..e341c6b43 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="850" height="1162" viewBox="-263 -26 850 1162">ba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnoteherescoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json index a51050906..39b144a5b 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -413,7 +413,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -532,7 +532,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1078,7 +1078,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1117,7 +1117,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1156,7 +1156,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1195,7 +1195,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1234,7 +1234,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1273,7 +1273,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1312,7 +1312,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1351,7 +1351,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1390,7 +1390,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg index b50e4e1a0..f2f4d06d7 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2447" height="2536" viewBox="-88 -88 2447 2536">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json index a98679802..72a7057a3 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg index a415d747a..7908c57da 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json index a98679802..72a7057a3 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg index a415d747a..7908c57da 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json index 24a642b5f..1ceb33052 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg index ea3486ab6..14dc4497b 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json index 24a642b5f..1ceb33052 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg index ea3486ab6..14dc4497b 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json index 50fdefffc..d63c990f4 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg index c61f0cb1b..f91003569 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json index 50fdefffc..d63c990f4 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg index c61f0cb1b..f91003569 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json index cbdb7a97f..e6fd7e966 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4161,7 +4161,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4200,7 +4200,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4239,7 +4239,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4278,7 +4278,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4317,7 +4317,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4356,7 +4356,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4395,7 +4395,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4434,7 +4434,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4473,7 +4473,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4512,7 +4512,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4551,7 +4551,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4590,7 +4590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4629,7 +4629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4668,7 +4668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4707,7 +4707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4746,7 +4746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4785,7 +4785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4824,7 +4824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg index eb0b93c75..5b7b87c12 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3402" height="4269" viewBox="-100 -100 3402 4269">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json index ed74bde39..7962381f1 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4080,7 +4080,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4119,7 +4119,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4158,7 +4158,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4197,7 +4197,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4236,7 +4236,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4275,7 +4275,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4314,7 +4314,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4353,7 +4353,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4392,7 +4392,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4431,7 +4431,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4470,7 +4470,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4509,7 +4509,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4548,7 +4548,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4587,7 +4587,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4626,7 +4626,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4665,7 +4665,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4704,7 +4704,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4743,7 +4743,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg index 98eabe978..515cfa72d 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="3324" height="4389" viewBox="-88 -88 3324 4389">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/square_3d/dagre/board.exp.json b/e2etests/testdata/stable/square_3d/dagre/board.exp.json index 961981fc6..8a037500b 100644 --- a/e2etests/testdata/stable/square_3d/dagre/board.exp.json +++ b/e2etests/testdata/stable/square_3d/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": true, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": true, diff --git a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg index 536b963fa..834d15ac7 100644 --- a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg @@ -20,9 +20,9 @@ width="371" height="580" viewBox="-100 -100 371 580"> -rectangle +rectangle -square -rectangle +rectangle -square acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc AKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDcontainerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json index f55ea2ba1..35b0e5dd0 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json +++ b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg index a80b6ae79..df3ac9c7a 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="536" height="663" viewBox="-88 -88 536 663">containerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json index 3dddb42bd..f3951de5d 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#A6B8F8", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg index 6a50fec38..bf4b4f2b7 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="664" height="716" viewBox="-100 -100 664 716">ninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneighteightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json index 54a4ee87e..d012e76be 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg index 1b1f29ab4..c417a43f7 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="789" height="2014" viewBox="-39 -88 789 2014">eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json index 4cf3eda9b..bf9dc2e70 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -563,7 +563,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -602,7 +602,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -641,7 +641,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#234CDA", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg index 96cc12cb0..45f3f9430 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="921" height="1242" viewBox="-147 -26 921 1242">bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel abc abc abc abc ab ab ab ab acbd acbd acbd acbd ab hello +ab hello ab hello +ab hello rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud cba * cba * cba * cba * ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* abcdefghijklmno abcdefghijklmno abcdefghijklmno abcdefghijklmno aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos1/elk/board.exp.json b/e2etests/testdata/stable/chaos1/elk/board.exp.json index d7fcac07d..592be572b 100644 --- a/e2etests/testdata/stable/chaos1/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos1/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg index 62b3bffda..8434d13b9 100644 --- a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="630" height="869" viewBox="-88 -88 630 869">aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos2/dagre/board.exp.json b/e2etests/testdata/stable/chaos2/dagre/board.exp.json index c928b6a24..c48e2c6ea 100644 --- a/e2etests/testdata/stable/chaos2/dagre/board.exp.json +++ b/e2etests/testdata/stable/chaos2/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg index 06d891441..e557f8e3d 100644 --- a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg @@ -774,8 +774,8 @@ width="1317" height="1854" viewBox="-100 -100 1317 1854">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/chaos2/elk/board.exp.json b/e2etests/testdata/stable/chaos2/elk/board.exp.json index 1aa503f04..b4ecab40f 100644 --- a/e2etests/testdata/stable/chaos2/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos2/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg index 174d4500f..5025c844b 100644 --- a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg @@ -774,8 +774,8 @@ width="1092" height="1907" viewBox="-88 -88 1092 1907">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json index 0ba6c70e2..1f3b3d8ea 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg index 89f73af80..e1f282145 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="724" height="626" viewBox="-100 -100 724 626">abcd abcd abcd abcd abc abc abc abc acfbdhg acfbdhg acfbdhg acfbdhg agdfbhec agdfbhec agdfbhec agdfbhec abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot bacde21345abcde bacde21345abcde bacde21345abcde bacde21345abcde alphabeta gamma +alphabeta gamma alphabeta gamma +alphabeta gamma size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/font_sizes/elk/board.exp.json b/e2etests/testdata/stable/font_sizes/elk/board.exp.json index 2d5446e61..498da91ca 100644 --- a/e2etests/testdata/stable/font_sizes/elk/board.exp.json +++ b/e2etests/testdata/stable/font_sizes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg index 02055f08d..fd230f08e 100644 --- a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1965" height="793" viewBox="-88 -88 1965 793">size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json index 62256201b..904218a42 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json @@ -53,7 +53,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg index 91b32cb2e..153ac2cc0 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg @@ -1031,7 +1031,7 @@ title for the link, surrounded in quotes. For example:

Code

Unlike a pre-formatted code block, a code span indicates code within a normal paragraph. For example:

-
ab hellohellohellohelloaabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/investigate/elk/board.exp.json b/e2etests/testdata/stable/investigate/elk/board.exp.json index 6e983b96d..d7887cee8 100644 --- a/e2etests/testdata/stable/investigate/elk/board.exp.json +++ b/e2etests/testdata/stable/investigate/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -505,7 +505,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -836,7 +836,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -876,7 +876,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -916,7 +916,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -996,7 +996,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1036,7 +1036,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1076,7 +1076,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1116,7 +1116,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1156,7 +1156,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1196,7 +1196,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1236,7 +1236,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg index 6655cd820..07d7c9369 100644 --- a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="860" height="4868" viewBox="-82 -88 860 4868">aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/large_arch/dagre/board.exp.json b/e2etests/testdata/stable/large_arch/dagre/board.exp.json index f62e8f5a5..86ef27a13 100644 --- a/e2etests/testdata/stable/large_arch/dagre/board.exp.json +++ b/e2etests/testdata/stable/large_arch/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -574,7 +574,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -614,7 +614,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -654,7 +654,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -694,7 +694,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -734,7 +734,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -774,7 +774,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -814,7 +814,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -894,7 +894,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -934,7 +934,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -974,7 +974,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1014,7 +1014,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1054,7 +1054,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1094,7 +1094,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1134,7 +1134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1174,7 +1174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1214,7 +1214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1254,7 +1254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1294,7 +1294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg index 13eab90b5..24bbbf19c 100644 --- a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3244" height="1780" viewBox="-100 -100 3244 1780">abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv mixed togethersugarsolution we get +mixed togethersugarsolution we get mixed togethersugarsolution we get +mixed togethersugarsolution we get

Markdown: Syntax

-
ab

Markdown: Syntax

-
ab markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

code

-
ab

code

-
ab thisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesabcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu Foo Baz12hello Foo Baz12hello Foo Baz12hello Foo Baz12hello acdefgbh acdefgbh acdefgbh acdefgbh topabcbottomstartend topabcbottomstartend topabcbottomstartend topabcbottomstartend xyz hello +xyz hello xyz hello +xyz hello an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json index 2341f4127..c110ffb9f 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -527,7 +527,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -566,7 +566,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -605,7 +605,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -644,7 +644,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -683,7 +683,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg index 0e9876acc..b23e2a894 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2692" height="1396" viewBox="-76 -26 2692 1396">an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json index 9f037376a..5ba5188b6 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg index b6bd742f3..d62bed291 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json index 9f037376a..5ba5188b6 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg index b6bd742f3..d62bed291 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json index bf7d446c6..46189a44c 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg index 225993ad1..d5d6aea8d 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json index bf7d446c6..46189a44c 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg index 225993ad1..d5d6aea8d 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json index d423c7d1d..ab449d330 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -213,7 +213,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -252,7 +252,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg index e341c6b43..1df8c0fea 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="850" height="1162" viewBox="-263 -26 850 1162">ba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnoteherescoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json index 39b144a5b..3c78207a7 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -413,7 +413,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -532,7 +532,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1078,7 +1078,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1117,7 +1117,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1156,7 +1156,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1195,7 +1195,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1234,7 +1234,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1273,7 +1273,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1312,7 +1312,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1351,7 +1351,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1390,7 +1390,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg index f2f4d06d7..84952ba2c 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2447" height="2536" viewBox="-88 -88 2447 2536">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json index 72a7057a3..6280730ef 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg index 7908c57da..acfa44a0f 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json index 72a7057a3..6280730ef 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg index 7908c57da..acfa44a0f 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json index 1ceb33052..61a83ea65 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg index 14dc4497b..514a06e0b 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json index 1ceb33052..61a83ea65 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg index 14dc4497b..514a06e0b 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json index d63c990f4..953ad57aa 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg index f91003569..8ab955b0b 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json index d63c990f4..953ad57aa 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg index f91003569..8ab955b0b 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json index e6fd7e966..7504a4d75 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4161,7 +4161,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4200,7 +4200,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4239,7 +4239,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4278,7 +4278,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4317,7 +4317,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4356,7 +4356,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4395,7 +4395,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4434,7 +4434,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4473,7 +4473,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4512,7 +4512,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4551,7 +4551,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4590,7 +4590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4629,7 +4629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4668,7 +4668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4707,7 +4707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4746,7 +4746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4785,7 +4785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4824,7 +4824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg index 5b7b87c12..fb00ca94b 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3402" height="4269" viewBox="-100 -100 3402 4269">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json index 7962381f1..a928d0fb8 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4080,7 +4080,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4119,7 +4119,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4158,7 +4158,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4197,7 +4197,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4236,7 +4236,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4275,7 +4275,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4314,7 +4314,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4353,7 +4353,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4392,7 +4392,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4431,7 +4431,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4470,7 +4470,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4509,7 +4509,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4548,7 +4548,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4587,7 +4587,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4626,7 +4626,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4665,7 +4665,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4704,7 +4704,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4743,7 +4743,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg index 515cfa72d..b8810283a 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="3324" height="4389" viewBox="-88 -88 3324 4389">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/square_3d/dagre/board.exp.json b/e2etests/testdata/stable/square_3d/dagre/board.exp.json index 8a037500b..ae0b398cd 100644 --- a/e2etests/testdata/stable/square_3d/dagre/board.exp.json +++ b/e2etests/testdata/stable/square_3d/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": true, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": true, diff --git a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg index 834d15ac7..8070f9471 100644 --- a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg @@ -20,9 +20,9 @@ width="371" height="580" viewBox="-100 -100 371 580"> -rectangle +rectangle -square -rectangle +rectangle -square acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc AKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDcontainerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json index 35b0e5dd0..aec76c448 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json +++ b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg index df3ac9c7a..e2c86e47a 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="536" height="663" viewBox="-88 -88 536 663">containerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json index f3951de5d..c36a465ab 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E3E9FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg index bf4b4f2b7..5dda9ae06 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="664" height="716" viewBox="-100 -100 664 716">ninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneighteightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json index d012e76be..dae1aff5b 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F7F8FE", + "fill": "#F4F6FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg index c417a43f7..f42b3ddce 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="789" height="2014" viewBox="-39 -88 789 2014">eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json index bf9dc2e70..8e5611289 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EDF0FD", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -563,7 +563,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -602,7 +602,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -641,7 +641,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#0D32B2", + "stroke": "#2952E4", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg index 45f3f9430..e9cb1975f 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="921" height="1242" viewBox="-147 -26 921 1242">bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json index 46189a44c..5f4deb35f 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg index d5d6aea8d..e70cbbc29 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/board.exp.json index 9637cd1a8..c07125eea 100644 --- a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/board.exp.json @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -330,7 +330,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -408,7 +408,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -487,7 +487,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -526,7 +526,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -565,7 +565,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -683,7 +683,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -722,7 +722,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -761,7 +761,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -878,7 +878,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg index aa51c655e..537ab773d 100644 --- a/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_nested_span/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="1626" viewBox="-76 -26 1624 1626">scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json index 3c78207a7..489789116 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json @@ -413,7 +413,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -532,7 +532,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg index 84952ba2c..c229cf631 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2447" height="2536" viewBox="-88 -88 2447 2536">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json index 6280730ef..95bd3ecee 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -211,7 +211,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg index acfa44a0f..516abbea1 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json index 6280730ef..95bd3ecee 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -211,7 +211,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg index acfa44a0f..516abbea1 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json index 953ad57aa..00c75c1a9 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -330,7 +330,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg index 8ab955b0b..9a2b4dca8 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json index 953ad57aa..00c75c1a9 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -330,7 +330,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg index 8ab955b0b..9a2b4dca8 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json index 7504a4d75..a87c5874a 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -810,7 +810,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1479,7 +1479,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1950,7 +1950,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2028,7 +2028,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2067,7 +2067,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2145,7 +2145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2184,7 +2184,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2301,7 +2301,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2340,7 +2340,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg index fb00ca94b..fab9122c5 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3402" height="4269" viewBox="-100 -100 3402 4269">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json index a928d0fb8..93a2f4d96 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -810,7 +810,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1479,7 +1479,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1950,7 +1950,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2028,7 +2028,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2067,7 +2067,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2145,7 +2145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2184,7 +2184,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2301,7 +2301,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#EEF1F8", + "fill": "#E7EAFF", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2340,7 +2340,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#FFFFFF", + "fill": "#EEF1F8", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#D2DBFD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg index b8810283a..b5128161a 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="3324" height="4389" viewBox="-88 -88 3324 4389">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) From d90eb355d3432731a6b9822573400b04d084164f Mon Sep 17 00:00:00 2001 From: Alexander Wang Date: Mon, 5 Dec 2022 14:30:40 -0800 Subject: [PATCH 26/29] prs --- d2exporter/export.go | 3 +-- d2graph/d2graph.go | 6 +++--- d2layouts/d2sequence/layout.go | 2 +- 3 files changed, 5 insertions(+), 6 deletions(-) diff --git a/d2exporter/export.go b/d2exporter/export.go index d39831a2e..1f2a15b8d 100644 --- a/d2exporter/export.go +++ b/d2exporter/export.go @@ -3,7 +3,6 @@ package d2exporter import ( "context" "strconv" - "strings" "oss.terrastruct.com/d2/d2graph" "oss.terrastruct.com/d2/d2target" @@ -100,7 +99,7 @@ func toShape(obj *d2graph.Object, theme *d2themes.Theme) d2target.Shape { shape.Italic = text.IsItalic shape.FontSize = text.FontSize - if strings.EqualFold(obj.Attributes.Shape.Value, d2target.ShapeSequenceDiagram) { + if obj.IsSequenceDiagram() { shape.StrokeWidth = 0 } diff --git a/d2graph/d2graph.go b/d2graph/d2graph.go index 3766d6d92..b7af9f2a3 100644 --- a/d2graph/d2graph.go +++ b/d2graph/d2graph.go @@ -343,12 +343,12 @@ func (obj *Object) GetFill(theme *d2themes.Theme) string { return theme.Colors.Neutrals.N7 } - shape := obj.Attributes.Shape.Value - - if strings.EqualFold(shape, d2target.ShapeSequenceDiagram) { + if obj.IsSequenceDiagram() { return theme.Colors.Neutrals.N7 } + shape := obj.Attributes.Shape.Value + if shape == "" || strings.EqualFold(shape, d2target.ShapeSquare) || strings.EqualFold(shape, d2target.ShapeCircle) || strings.EqualFold(shape, d2target.ShapeOval) || strings.EqualFold(shape, d2target.ShapeRectangle) { if level == 1 { if !obj.IsContainer() { diff --git a/d2layouts/d2sequence/layout.go b/d2layouts/d2sequence/layout.go index 77f3c6a7d..6a9498642 100644 --- a/d2layouts/d2sequence/layout.go +++ b/d2layouts/d2sequence/layout.go @@ -156,7 +156,7 @@ func cleanup(g *d2graph.Graph, sequenceDiagrams map[string]*sequenceDiagram, obj obj.ChildrenArray = append(obj.ChildrenArray, child) } for _, child := range sd.groups { - if child.Parent == obj { + if child.Parent.AbsID() == obj.AbsID() { obj.Children[child.ID] = child obj.ChildrenArray = append(obj.ChildrenArray, child) } From 9e523015bf8dc8f16903c6f819138094fda876cb Mon Sep 17 00:00:00 2001 From: Alexander Wang Date: Mon, 5 Dec 2022 14:40:14 -0800 Subject: [PATCH 27/29] rever theme change for now --- d2themes/d2themescatalog/default.go | 20 +-- e2etests/stable_test.go | 3 +- .../sanity/1_to_2/dagre/board.exp.json | 6 +- .../sanity/1_to_2/dagre/sketch.exp.svg | 2 +- .../testdata/sanity/1_to_2/elk/board.exp.json | 6 +- .../testdata/sanity/1_to_2/elk/sketch.exp.svg | 2 +- .../sanity/basic/dagre/board.exp.json | 4 +- .../sanity/basic/dagre/sketch.exp.svg | 2 +- .../testdata/sanity/basic/elk/board.exp.json | 4 +- .../testdata/sanity/basic/elk/sketch.exp.svg | 2 +- .../child_to_child/dagre/board.exp.json | 8 +- .../child_to_child/dagre/sketch.exp.svg | 2 +- .../sanity/child_to_child/elk/board.exp.json | 8 +- .../sanity/child_to_child/elk/sketch.exp.svg | 2 +- .../connection_label/dagre/board.exp.json | 4 +- .../connection_label/dagre/sketch.exp.svg | 2 +- .../connection_label/elk/board.exp.json | 4 +- .../connection_label/elk/sketch.exp.svg | 2 +- .../stable/all_shapes/dagre/board.exp.json | 22 +-- .../stable/all_shapes/dagre/sketch.exp.svg | 2 +- .../stable/all_shapes/elk/board.exp.json | 22 +-- .../stable/all_shapes/elk/sketch.exp.svg | 2 +- .../all_shapes_multiple/dagre/board.exp.json | 22 +-- .../all_shapes_multiple/dagre/sketch.exp.svg | 2 +- .../all_shapes_multiple/elk/board.exp.json | 22 +-- .../all_shapes_multiple/elk/sketch.exp.svg | 2 +- .../all_shapes_shadow/dagre/board.exp.json | 22 +-- .../all_shapes_shadow/dagre/sketch.exp.svg | 2 +- .../all_shapes_shadow/elk/board.exp.json | 22 +-- .../all_shapes_shadow/elk/sketch.exp.svg | 2 +- .../arrowhead_adjustment/dagre/board.exp.json | 10 +- .../arrowhead_adjustment/dagre/sketch.exp.svg | 2 +- .../arrowhead_adjustment/elk/board.exp.json | 10 +- .../arrowhead_adjustment/elk/sketch.exp.svg | 2 +- .../arrowhead_labels/dagre/board.exp.json | 4 +- .../arrowhead_labels/dagre/sketch.exp.svg | 2 +- .../arrowhead_labels/elk/board.exp.json | 4 +- .../arrowhead_labels/elk/sketch.exp.svg | 2 +- .../stable/binary_tree/dagre/board.exp.json | 30 ++-- .../stable/binary_tree/dagre/sketch.exp.svg | 2 +- .../stable/binary_tree/elk/board.exp.json | 30 ++-- .../stable/binary_tree/elk/sketch.exp.svg | 2 +- .../stable/chaos1/dagre/board.exp.json | 8 +- .../stable/chaos1/dagre/sketch.exp.svg | 2 +- .../testdata/stable/chaos1/elk/board.exp.json | 8 +- .../testdata/stable/chaos1/elk/sketch.exp.svg | 2 +- .../stable/chaos2/dagre/board.exp.json | 16 +- .../stable/chaos2/dagre/sketch.exp.svg | 4 +- .../testdata/stable/chaos2/elk/board.exp.json | 16 +- .../testdata/stable/chaos2/elk/sketch.exp.svg | 4 +- .../child_parent_edges/dagre/board.exp.json | 6 +- .../child_parent_edges/dagre/sketch.exp.svg | 2 +- .../child_parent_edges/elk/board.exp.json | 6 +- .../child_parent_edges/elk/sketch.exp.svg | 2 +- .../circular_dependency/dagre/board.exp.json | 6 +- .../circular_dependency/dagre/sketch.exp.svg | 2 +- .../circular_dependency/elk/board.exp.json | 6 +- .../circular_dependency/elk/sketch.exp.svg | 2 +- .../stable/code_snippet/dagre/board.exp.json | 4 +- .../stable/code_snippet/dagre/sketch.exp.svg | 2 +- .../stable/code_snippet/elk/board.exp.json | 4 +- .../stable/code_snippet/elk/sketch.exp.svg | 2 +- .../connected_container/dagre/board.exp.json | 14 +- .../connected_container/dagre/sketch.exp.svg | 2 +- .../connected_container/elk/board.exp.json | 14 +- .../connected_container/elk/sketch.exp.svg | 2 +- .../container_edges/dagre/board.exp.json | 16 +- .../container_edges/dagre/sketch.exp.svg | 2 +- .../stable/container_edges/elk/board.exp.json | 16 +- .../stable/container_edges/elk/sketch.exp.svg | 2 +- .../stable/dense/dagre/board.exp.json | 34 ++--- .../stable/dense/dagre/sketch.exp.svg | 2 +- .../testdata/stable/dense/elk/board.exp.json | 34 ++--- .../testdata/stable/dense/elk/sketch.exp.svg | 2 +- .../different_subgraphs/dagre/board.exp.json | 44 +++--- .../different_subgraphs/dagre/sketch.exp.svg | 2 +- .../different_subgraphs/elk/board.exp.json | 44 +++--- .../different_subgraphs/elk/sketch.exp.svg | 2 +- .../stable/direction/dagre/board.exp.json | 30 ++-- .../stable/direction/dagre/sketch.exp.svg | 2 +- .../stable/direction/elk/board.exp.json | 30 ++-- .../stable/direction/elk/sketch.exp.svg | 2 +- .../stable/font_colors/dagre/board.exp.json | 4 +- .../stable/font_colors/dagre/sketch.exp.svg | 2 +- .../stable/font_colors/elk/board.exp.json | 4 +- .../stable/font_colors/elk/sketch.exp.svg | 2 +- .../stable/font_sizes/dagre/board.exp.json | 24 +-- .../stable/font_sizes/dagre/sketch.exp.svg | 2 +- .../stable/font_sizes/elk/board.exp.json | 24 +-- .../stable/font_sizes/elk/sketch.exp.svg | 2 +- .../giant_markdown_test/dagre/board.exp.json | 4 +- .../giant_markdown_test/dagre/sketch.exp.svg | 2 +- .../giant_markdown_test/elk/board.exp.json | 4 +- .../giant_markdown_test/elk/sketch.exp.svg | 2 +- .../testdata/stable/hr/dagre/board.exp.json | 4 +- .../testdata/stable/hr/dagre/sketch.exp.svg | 2 +- .../testdata/stable/hr/elk/board.exp.json | 4 +- .../testdata/stable/hr/elk/sketch.exp.svg | 2 +- .../stable/icon-label/dagre/board.exp.json | 2 +- .../stable/icon-label/dagre/sketch.exp.svg | 2 +- .../stable/icon-label/elk/board.exp.json | 2 +- .../stable/icon-label/elk/sketch.exp.svg | 2 +- .../stable/investigate/dagre/board.exp.json | 50 +++--- .../stable/investigate/dagre/sketch.exp.svg | 2 +- .../stable/investigate/elk/board.exp.json | 50 +++--- .../stable/investigate/elk/sketch.exp.svg | 2 +- .../stable/large_arch/dagre/board.exp.json | 64 ++++---- .../stable/large_arch/dagre/sketch.exp.svg | 2 +- .../stable/large_arch/elk/board.exp.json | 64 ++++---- .../stable/large_arch/elk/sketch.exp.svg | 2 +- .../stable/latex/dagre/board.exp.json | 6 +- .../stable/latex/dagre/sketch.exp.svg | 2 +- .../testdata/stable/latex/elk/board.exp.json | 6 +- .../testdata/stable/latex/elk/sketch.exp.svg | 2 +- .../testdata/stable/li1/dagre/board.exp.json | 4 +- .../testdata/stable/li1/dagre/sketch.exp.svg | 2 +- .../testdata/stable/li1/elk/board.exp.json | 4 +- .../testdata/stable/li1/elk/sketch.exp.svg | 2 +- .../testdata/stable/li2/dagre/board.exp.json | 4 +- .../testdata/stable/li2/dagre/sketch.exp.svg | 2 +- .../testdata/stable/li2/elk/board.exp.json | 4 +- .../testdata/stable/li2/elk/sketch.exp.svg | 2 +- .../testdata/stable/li3/dagre/board.exp.json | 4 +- .../testdata/stable/li3/dagre/sketch.exp.svg | 2 +- .../testdata/stable/li3/elk/board.exp.json | 4 +- .../testdata/stable/li3/elk/sketch.exp.svg | 2 +- .../testdata/stable/li4/dagre/board.exp.json | 4 +- .../testdata/stable/li4/dagre/sketch.exp.svg | 2 +- .../testdata/stable/li4/elk/board.exp.json | 4 +- .../testdata/stable/li4/elk/sketch.exp.svg | 2 +- .../stable/lone_h1/dagre/board.exp.json | 4 +- .../stable/lone_h1/dagre/sketch.exp.svg | 2 +- .../stable/lone_h1/elk/board.exp.json | 4 +- .../stable/lone_h1/elk/sketch.exp.svg | 2 +- .../stable/markdown/dagre/board.exp.json | 4 +- .../stable/markdown/dagre/sketch.exp.svg | 2 +- .../stable/markdown/elk/board.exp.json | 4 +- .../stable/markdown/elk/sketch.exp.svg | 2 +- .../md_2space_newline/dagre/board.exp.json | 2 +- .../md_2space_newline/dagre/sketch.exp.svg | 2 +- .../md_2space_newline/elk/board.exp.json | 2 +- .../md_2space_newline/elk/sketch.exp.svg | 2 +- .../md_backslash_newline/dagre/board.exp.json | 2 +- .../md_backslash_newline/dagre/sketch.exp.svg | 2 +- .../md_backslash_newline/elk/board.exp.json | 2 +- .../md_backslash_newline/elk/sketch.exp.svg | 2 +- .../md_code_block_fenced/dagre/board.exp.json | 4 +- .../md_code_block_fenced/dagre/sketch.exp.svg | 2 +- .../md_code_block_fenced/elk/board.exp.json | 4 +- .../md_code_block_fenced/elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 4 +- .../dagre/sketch.exp.svg | 2 +- .../md_code_block_indented/elk/board.exp.json | 4 +- .../md_code_block_indented/elk/sketch.exp.svg | 2 +- .../md_code_inline/dagre/board.exp.json | 4 +- .../md_code_inline/dagre/sketch.exp.svg | 2 +- .../stable/md_code_inline/elk/board.exp.json | 4 +- .../stable/md_code_inline/elk/sketch.exp.svg | 2 +- .../multiline_text/dagre/board.exp.json | 2 +- .../multiline_text/dagre/sketch.exp.svg | 2 +- .../stable/multiline_text/elk/board.exp.json | 2 +- .../stable/multiline_text/elk/sketch.exp.svg | 2 +- .../multiple_trees/dagre/board.exp.json | 46 +++--- .../multiple_trees/dagre/sketch.exp.svg | 2 +- .../stable/multiple_trees/elk/board.exp.json | 46 +++--- .../stable/multiple_trees/elk/sketch.exp.svg | 2 +- .../stable/n22_e32/dagre/board.exp.json | 42 ++--- .../stable/n22_e32/dagre/sketch.exp.svg | 2 +- .../stable/n22_e32/elk/board.exp.json | 42 ++--- .../stable/n22_e32/elk/sketch.exp.svg | 2 +- .../number_connections/dagre/board.exp.json | 8 +- .../number_connections/dagre/sketch.exp.svg | 2 +- .../number_connections/elk/board.exp.json | 8 +- .../number_connections/elk/sketch.exp.svg | 2 +- .../one_container_loop/dagre/board.exp.json | 16 +- .../one_container_loop/dagre/sketch.exp.svg | 2 +- .../one_container_loop/elk/board.exp.json | 16 +- .../one_container_loop/elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 14 +- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 14 +- .../elk/sketch.exp.svg | 2 +- .../testdata/stable/p/dagre/board.exp.json | 4 +- .../testdata/stable/p/dagre/sketch.exp.svg | 2 +- e2etests/testdata/stable/p/elk/board.exp.json | 4 +- e2etests/testdata/stable/p/elk/sketch.exp.svg | 2 +- .../testdata/stable/pre/dagre/board.exp.json | 4 +- .../testdata/stable/pre/dagre/sketch.exp.svg | 2 +- .../testdata/stable/pre/elk/board.exp.json | 4 +- .../testdata/stable/pre/elk/sketch.exp.svg | 2 +- .../self-referencing/dagre/board.exp.json | 6 +- .../self-referencing/dagre/sketch.exp.svg | 2 +- .../self-referencing/elk/board.exp.json | 6 +- .../self-referencing/elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 24 +-- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 24 +-- .../elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 80 +++++----- .../dagre/sketch.exp.svg | 8 +- .../elk/board.exp.json | 80 +++++----- .../elk/sketch.exp.svg | 8 +- .../dagre/board.exp.json | 22 +-- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 22 +-- .../elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 8 +- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 8 +- .../elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 12 +- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 12 +- .../elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 44 +++--- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 44 +++--- .../elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 16 +- .../dagre/sketch.exp.svg | 2 +- .../sequence_diagram_note/elk/board.exp.json | 16 +- .../sequence_diagram_note/elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 40 ++--- .../dagre/sketch.exp.svg | 2 +- .../sequence_diagram_real/elk/board.exp.json | 40 ++--- .../sequence_diagram_real/elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 18 +-- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 18 +-- .../elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 24 +-- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 24 +-- .../elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 46 +++--- .../dagre/sketch.exp.svg | 2 +- .../sequence_diagram_span/elk/board.exp.json | 46 +++--- .../sequence_diagram_span/elk/sketch.exp.svg | 2 +- .../sequence_diagrams/dagre/board.exp.json | 144 +++++++++--------- .../sequence_diagrams/dagre/sketch.exp.svg | 2 +- .../sequence_diagrams/elk/board.exp.json | 144 +++++++++--------- .../sequence_diagrams/elk/sketch.exp.svg | 2 +- .../stable/square_3d/dagre/board.exp.json | 4 +- .../stable/square_3d/dagre/sketch.exp.svg | 4 +- .../stable/square_3d/elk/board.exp.json | 4 +- .../stable/square_3d/elk/sketch.exp.svg | 4 +- .../dagre/board.exp.json | 50 +++--- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 50 +++--- .../elk/sketch.exp.svg | 2 +- .../stable/us_map/dagre/board.exp.json | 100 ++++++------ .../stable/us_map/dagre/sketch.exp.svg | 2 +- .../testdata/stable/us_map/elk/board.exp.json | 100 ++++++------ .../testdata/stable/us_map/elk/sketch.exp.svg | 2 +- .../container_child_edge/dagre/board.exp.json | 6 +- .../container_child_edge/dagre/sketch.exp.svg | 2 +- .../container_child_edge/elk/board.exp.json | 6 +- .../container_child_edge/elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 6 +- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 6 +- .../elk/sketch.exp.svg | 2 +- .../font_sizes_large/dagre/board.exp.json | 10 +- .../font_sizes_large/dagre/sketch.exp.svg | 2 +- .../todo/font_sizes_large/elk/board.exp.json | 10 +- .../todo/font_sizes_large/elk/sketch.exp.svg | 2 +- .../dagre/board.exp.json | 12 +- .../dagre/sketch.exp.svg | 2 +- .../elk/board.exp.json | 12 +- .../elk/sketch.exp.svg | 2 +- .../todo/tall_edge_label/dagre/board.exp.json | 4 +- .../todo/tall_edge_label/dagre/sketch.exp.svg | 2 +- .../todo/tall_edge_label/elk/board.exp.json | 4 +- .../todo/tall_edge_label/elk/sketch.exp.svg | 2 +- 274 files changed, 1478 insertions(+), 1477 deletions(-) diff --git a/d2themes/d2themescatalog/default.go b/d2themes/d2themescatalog/default.go index bd240a16d..6fd3fb878 100644 --- a/d2themes/d2themescatalog/default.go +++ b/d2themes/d2themescatalog/default.go @@ -9,17 +9,17 @@ var NeutralDefault = d2themes.Theme{ Neutrals: d2themes.CoolNeutral, B1: "#0D32B2", - B2: "#2952E4", - B3: "#B0C0FB", - B4: "#D2DBFD", - B5: "#E7EAFF", - B6: "#F4F6FD", + B2: "#0D32B2", + B3: "#E3E9FD", + B4: "#E3E9FD", + B5: "#EDF0FD", + B6: "#F7F8FE", - AA2: "#2952E4", - AA4: "#D2DBFD", - AA5: "#E7EAFF", + AA2: "#4A6FF3", + AA4: "#EDF0FD", + AA5: "#F7F8FE", - AB4: "#D2DBFD", - AB5: "#E7EAFF", + AB4: "#EDF0FD", + AB5: "#F7F8FE", }, } diff --git a/e2etests/stable_test.go b/e2etests/stable_test.go index 22d6b86ec..230528899 100644 --- a/e2etests/stable_test.go +++ b/e2etests/stable_test.go @@ -1451,7 +1451,8 @@ c: "just an actor" d2exporter.export -> CLI: resulting SVG } `, - }, { + }, + { name: "sequence_diagram_actor_distance", script: `shape: sequence_diagram a: "an actor with a really long label that will break everything" diff --git a/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json b/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json index 68718fd35..53c443478 100644 --- a/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json +++ b/e2etests/testdata/sanity/1_to_2/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg b/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg index bb1c3505b..d38113b44 100644 --- a/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg +++ b/e2etests/testdata/sanity/1_to_2/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="486" height="552" viewBox="-100 -100 486 552">abc abc abc abc ab ab ab ab acbd acbd acbd acbd ab hello +ab hello ab hello +ab hello rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud rectanglesquarepageparallelogramdocumentcylinderqueuepackagestepcalloutstored_datapersondiamondovalcirclehexagoncloud cba * cba * cba * cba * ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* ab To err is human, to moo bovine1* +ab To err is human, to moo bovine1* abcdefghijklmno abcdefghijklmno abcdefghijklmno abcdefghijklmno aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos1/elk/board.exp.json b/e2etests/testdata/stable/chaos1/elk/board.exp.json index 592be572b..d7fcac07d 100644 --- a/e2etests/testdata/stable/chaos1/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos1/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg index 8434d13b9..62b3bffda 100644 --- a/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos1/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="630" height="869" viewBox="-88 -88 630 869">aaadddeeebbbccc111 222 +aaadddeeebbbccc111 222 diff --git a/e2etests/testdata/stable/chaos2/dagre/board.exp.json b/e2etests/testdata/stable/chaos2/dagre/board.exp.json index c48e2c6ea..c928b6a24 100644 --- a/e2etests/testdata/stable/chaos2/dagre/board.exp.json +++ b/e2etests/testdata/stable/chaos2/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg index e557f8e3d..06d891441 100644 --- a/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/dagre/sketch.exp.svg @@ -774,8 +774,8 @@ width="1317" height="1854" viewBox="-100 -100 1317 1854">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/chaos2/elk/board.exp.json b/e2etests/testdata/stable/chaos2/elk/board.exp.json index b4ecab40f..1aa503f04 100644 --- a/e2etests/testdata/stable/chaos2/elk/board.exp.json +++ b/e2etests/testdata/stable/chaos2/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -332,7 +332,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -412,7 +412,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -571,7 +571,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg index 5025c844b..174d4500f 100644 --- a/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/chaos2/elk/sketch.exp.svg @@ -774,8 +774,8 @@ width="1092" height="1907" viewBox="-88 -88 1092 1907">aabbllmm

nn

-
oocciikkdd

gg

+aabbllmm

nn

+
oocciikkdd

gg

hhjj

ee

ff1122 334455667788 diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json index 1f3b3d8ea..0ba6c70e2 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/child_parent_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg index e1f282145..89f73af80 100644 --- a/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/child_parent_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="724" height="626" viewBox="-100 -100 724 626">abcd abcd abcd abcd abc abc abc abc acfbdhg acfbdhg acfbdhg acfbdhg agdfbhec agdfbhec agdfbhec agdfbhec abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq abcdefghijklmnopq finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot finallyatreeandnodessomemoremanythenhereyouhavehierarchyanotherofnestingtreesatreeinsidehierarchyroot bacde21345abcde bacde21345abcde bacde21345abcde bacde21345abcde alphabeta gamma +alphabeta gamma alphabeta gamma +alphabeta gamma size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/font_sizes/elk/board.exp.json b/e2etests/testdata/stable/font_sizes/elk/board.exp.json index 498da91ca..2d5446e61 100644 --- a/e2etests/testdata/stable/font_sizes/elk/board.exp.json +++ b/e2etests/testdata/stable/font_sizes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg index fd230f08e..02055f08d 100644 --- a/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/font_sizes/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1965" height="793" viewBox="-88 -88 1965 793">size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 +size XSsize Ssize Msize Lsize XLsize XXLsize XXXLcustom 8custom 12custom 18custom 21custom 64 custom 10custom 15custom 48 diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json index 904218a42..62256201b 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/board.exp.json @@ -53,7 +53,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg index 153ac2cc0..91b32cb2e 100644 --- a/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/giant_markdown_test/dagre/sketch.exp.svg @@ -1031,7 +1031,7 @@ title for the link, surrounded in quotes. For example:

Code

Unlike a pre-formatted code block, a code span indicates code within a normal paragraph. For example:

-
ab hellohellohellohelloaabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/investigate/elk/board.exp.json b/e2etests/testdata/stable/investigate/elk/board.exp.json index d7887cee8..6e983b96d 100644 --- a/e2etests/testdata/stable/investigate/elk/board.exp.json +++ b/e2etests/testdata/stable/investigate/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -505,7 +505,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -836,7 +836,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -876,7 +876,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -916,7 +916,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -996,7 +996,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1036,7 +1036,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1076,7 +1076,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1116,7 +1116,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1156,7 +1156,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1196,7 +1196,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1236,7 +1236,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg index 07d7c9369..6655cd820 100644 --- a/e2etests/testdata/stable/investigate/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/investigate/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="860" height="4868" viewBox="-82 -88 860 4868">aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 +aabbccddllffwwyynniijjkkssuurmeemmmmgghhzzooppqqrrttvvxxabac 123456 diff --git a/e2etests/testdata/stable/large_arch/dagre/board.exp.json b/e2etests/testdata/stable/large_arch/dagre/board.exp.json index 86ef27a13..f62e8f5a5 100644 --- a/e2etests/testdata/stable/large_arch/dagre/board.exp.json +++ b/e2etests/testdata/stable/large_arch/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -574,7 +574,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -614,7 +614,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -654,7 +654,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -694,7 +694,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -734,7 +734,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -774,7 +774,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -814,7 +814,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -894,7 +894,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -934,7 +934,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -974,7 +974,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1014,7 +1014,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1054,7 +1054,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1094,7 +1094,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1134,7 +1134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1174,7 +1174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1214,7 +1214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1254,7 +1254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1294,7 +1294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg index 24bbbf19c..13eab90b5 100644 --- a/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/large_arch/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3244" height="1780" viewBox="-100 -100 3244 1780">abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv abcdefghiqrjmnoszaabbeeffggklptuwxyccddv mixed togethersugarsolution we get +mixed togethersugarsolution we get mixed togethersugarsolution we get +mixed togethersugarsolution we get

Markdown: Syntax

-
ab

Markdown: Syntax

-
ab markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
+markdown

Lorem ipsum dolor sit amet, consectetur adipiscing elit,
sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.

code

-
ab

code

-
ab thisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesthisgoesmultiple linesabcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstuvw abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu abcdefghijklmnopqrstu Foo Baz12hello Foo Baz12hello Foo Baz12hello Foo Baz12hello acdefgbh acdefgbh acdefgbh acdefgbh topabcbottomstartend topabcbottomstartend topabcbottomstartend topabcbottomstartend xyz hello +xyz hello xyz hello +xyz hello an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json index c110ffb9f..2341f4127 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -527,7 +527,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -566,7 +566,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -605,7 +605,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -644,7 +644,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -683,7 +683,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg index b23e2a894..0e9876acc 100644 --- a/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_actor_distance/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2692" height="1396" viewBox="-76 -26 2692 1396">an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long +an actor with a really long label that will break everythinganactorwithareallylonglabelthatwillbreakeverythingsimplea short onefar awaywhat if there were no labels between this actor and the previous one shortlong label for testing purposes and it must be really, really longshortthis should span many actors lifelines so we know how it will look like when redering a long label over many actorslong label for testing purposes and it must be really, really long diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json index 5ba5188b6..9f037376a 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg index d62bed291..b6bd742f3 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/dagre/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json index 5ba5188b6..9f037376a 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -145,7 +145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -185,7 +185,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -225,7 +225,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -265,7 +265,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -305,7 +305,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -345,7 +345,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -385,7 +385,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -436,7 +436,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -476,7 +476,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -516,7 +516,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -556,7 +556,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -596,7 +596,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -636,7 +636,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -676,7 +676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -716,7 +716,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -756,7 +756,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -796,7 +796,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0A0F25", "shadow": false, "3d": false, @@ -1590,7 +1590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1629,7 +1629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1668,7 +1668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1707,7 +1707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1746,7 +1746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1785,7 +1785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1824,7 +1824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1863,7 +1863,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1902,7 +1902,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1941,7 +1941,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1980,7 +1980,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2019,7 +2019,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2058,7 +2058,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2097,7 +2097,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2136,7 +2136,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2175,7 +2175,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2214,7 +2214,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2253,7 +2253,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2292,7 +2292,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -2331,7 +2331,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg index d62bed291..b6bd742f3 100644 --- a/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_all_shapes/elk/sketch.exp.svg @@ -18,17 +18,17 @@ width="5145" height="2984" viewBox="-76 -26 5145 2984">a labelblabelsa class+ +a labelblabelsa class+ public() bool void- private() int -voidcloudyyyya := 5 +voidcloudyyyya := 5 b := a + 7 -fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid +fmt.Printf("%d", b)cyldiadocssix cornersa random iconoverpackdocs pagetoohard o saysinglepersona queuea squarea step at a timedatausersid int name varchar - result := callThisFunction(obj, 5) midthis sideother side + result := callThisFunction(obj, 5) midthis sideother side diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json index 5f4deb35f..3fd82835d 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg index e70cbbc29..ec8e7b216 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json index 5f4deb35f..3fd82835d 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -449,7 +449,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -956,7 +956,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -995,7 +995,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1034,7 +1034,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1073,7 +1073,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg index e70cbbc29..ec8e7b216 100644 --- a/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_groups/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1147" height="2268" viewBox="-76 -26 1147 2268">abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note +abcdggggroup 1group bchoonested guy lalaeyokayokaywhat would arnold saythis note diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json index ab449d330..d423c7d1d 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -213,7 +213,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -252,7 +252,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg index 1df8c0fea..e341c6b43 100644 --- a/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_long_note/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="850" height="1162" viewBox="-263 -26 850 1162">ba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereba a note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnotehereabjust an actorthis is a message groupaltand this is a nested message groupcase 1case 2case 3case 4what about more nestingcrazy townwhoa a notea note here to remember that padding must consider notes toojustalongnoteherescoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome scoreritemResponseitemessayRubricconceptitemOutcome abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier +abcd okayexplanationanother explanationSome one who believes imaginary things appear right before your i's.The earth is like a tiny grain of sand, only much, much heavier How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json index 489789116..b303818b1 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/board.exp.json @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -214,7 +214,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -413,7 +413,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -452,7 +452,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -492,7 +492,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -532,7 +532,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1078,7 +1078,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1117,7 +1117,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1156,7 +1156,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1195,7 +1195,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1234,7 +1234,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1273,7 +1273,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1312,7 +1312,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1351,7 +1351,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1390,7 +1390,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg index c229cf631..9e6ceb66d 100644 --- a/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_real/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="2447" height="2536" viewBox="-88 -88 2447 2536">How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place +How this is renderedCLId2astd2compilerd2layoutd2exporterd2themesd2rendererd2sequencelayoutd2dagrelayoutonly if root is not sequence 'How this is rendered: {...}'tokenized ASTcompile ASTobjects and edgesrun layout enginesrun engine on shape: sequence_diagram, temporarily removerun core engine on rest add back in sequence diagramsdiagram with correct positions and dimensionsexport diagram with chosen theme and rendererget theme stylesrender to SVGresulting SVGmeasurements also take place diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json index 95bd3ecee..4c8d9cd09 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -211,7 +211,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg index 516abbea1..f27e77a00 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json index 95bd3ecee..4c8d9cd09 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -211,7 +211,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -250,7 +250,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -594,7 +594,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -633,7 +633,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg index 516abbea1..f27e77a00 100644 --- a/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_self_edges/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="696" height="1366" viewBox="-76 -26 696 1366">ab a self edge herebetween actorsto descendantto deeper descendantto parentactor +ab a self edge herebetween actorsto descendantto deeper descendantto parentactor diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json index 61a83ea65..1ceb33052 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg index 514a06e0b..14dc4497b 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json index 61a83ea65..1ceb33052 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "red", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 5, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -331,7 +331,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -370,7 +370,7 @@ "opacity": 1, "strokeDash": 4, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -604,7 +604,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -643,7 +643,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -682,7 +682,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -721,7 +721,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -760,7 +760,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg index 514a06e0b..14dc4497b 100644 --- a/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_simple/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1589" height="1868" viewBox="-76 -26 1589 1868">AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentials Authentication ResponseAnother authentication Requestdo it later storedAnother authentication Response +AlicelinebreakerBobdbqueueanoddservicewithanameinmultiple lines Authentication Requestmake request for something that is quite far away and requires a really long label to take all the space between the objectsvalidate credentialsAuthentication ResponseAnother authentication Requestdo it later storedAnother authentication Response diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json index 00c75c1a9..af401f123 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -330,7 +330,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg index 9a2b4dca8..a38b8914f 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json index 00c75c1a9..af401f123 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -93,7 +93,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -133,7 +133,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -172,7 +172,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -212,7 +212,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -251,7 +251,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -291,7 +291,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -330,7 +330,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -369,7 +369,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -409,7 +409,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -448,7 +448,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -488,7 +488,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -527,7 +527,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -566,7 +566,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -605,7 +605,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -644,7 +644,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1190,7 +1190,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1229,7 +1229,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1268,7 +1268,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1307,7 +1307,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1346,7 +1346,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -1385,7 +1385,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg index 9a2b4dca8..a38b8914f 100644 --- a/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagram_span/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="1624" height="2146" viewBox="-76 -26 1624 2146">scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +scoreritemResponseitemessayRubricconceptitemOutcome getItem() itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json index a87c5874a..fb7550f69 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -810,7 +810,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1479,7 +1479,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1950,7 +1950,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2028,7 +2028,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2145,7 +2145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2301,7 +2301,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4161,7 +4161,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4200,7 +4200,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4239,7 +4239,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4278,7 +4278,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4317,7 +4317,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4356,7 +4356,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4395,7 +4395,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4434,7 +4434,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4473,7 +4473,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4512,7 +4512,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4551,7 +4551,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4590,7 +4590,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4629,7 +4629,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4668,7 +4668,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4707,7 +4707,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4746,7 +4746,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4785,7 +4785,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4824,7 +4824,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg index fab9122c5..cc85ee061 100644 --- a/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="3402" height="4269" viewBox="-100 -100 3402 4269">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json index 93a2f4d96..3ed298e02 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json +++ b/e2etests/testdata/stable/sequence_diagrams/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -254,7 +254,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -294,7 +294,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -334,7 +334,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -374,7 +374,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -414,7 +414,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -454,7 +454,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -494,7 +494,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -534,7 +534,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -573,7 +573,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -613,7 +613,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -652,7 +652,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -692,7 +692,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -731,7 +731,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -771,7 +771,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -810,7 +810,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -849,7 +849,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -889,7 +889,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -928,7 +928,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -968,7 +968,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1007,7 +1007,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1046,7 +1046,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1085,7 +1085,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1124,7 +1124,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1163,7 +1163,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1203,7 +1203,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1242,7 +1242,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1282,7 +1282,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1321,7 +1321,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1361,7 +1361,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1400,7 +1400,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1440,7 +1440,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1479,7 +1479,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1518,7 +1518,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1558,7 +1558,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1597,7 +1597,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1637,7 +1637,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1676,7 +1676,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1715,7 +1715,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1754,7 +1754,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1793,7 +1793,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1832,7 +1832,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1872,7 +1872,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1911,7 +1911,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1950,7 +1950,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -1989,7 +1989,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2028,7 +2028,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2106,7 +2106,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2145,7 +2145,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2262,7 +2262,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2301,7 +2301,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2457,7 +2457,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -2496,7 +2496,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -4080,7 +4080,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4119,7 +4119,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4158,7 +4158,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4197,7 +4197,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4236,7 +4236,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4275,7 +4275,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4314,7 +4314,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4353,7 +4353,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4392,7 +4392,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4431,7 +4431,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4470,7 +4470,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4509,7 +4509,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4548,7 +4548,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4587,7 +4587,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4626,7 +4626,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4665,7 +4665,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4704,7 +4704,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -4743,7 +4743,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg index b5128161a..ac2e03f6c 100644 --- a/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg +++ b/e2etests/testdata/stable/sequence_diagrams/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="3324" height="4389" viewBox="-88 -88 3324 4389">a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) +a_shapea_sequenceanotherfinallysequencesequencesequencescoreritemResponseitemessayRubricconceptitemOutcomescorerconceptessayRubricitemitemOutcomeitemResponsescoreritemResponseitemessayRubricconceptitemOutcome getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts)getItem()itemgetRubric()rubricapplyTo(essayResp)match(essayResponse)scorenewgetNormalMinimum()getNormalMaximum()setScore(score)setFeedback(missingConcepts) diff --git a/e2etests/testdata/stable/square_3d/dagre/board.exp.json b/e2etests/testdata/stable/square_3d/dagre/board.exp.json index ae0b398cd..8a037500b 100644 --- a/e2etests/testdata/stable/square_3d/dagre/board.exp.json +++ b/e2etests/testdata/stable/square_3d/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": true, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": true, diff --git a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg index 8070f9471..834d15ac7 100644 --- a/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg +++ b/e2etests/testdata/stable/square_3d/dagre/sketch.exp.svg @@ -20,9 +20,9 @@ width="371" height="580" viewBox="-100 -100 371 580"> -rectangle +rectangle -square -rectangle +rectangle -square acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc acbl1l2c1l2c3l2c2l3c1l3c2l4bacacbabcc1c2c3abc AKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDAKHIALFLGAMSTNAZCANVNMUTARLAMOOKTXORCOKSNEWYCTMANYRIDEMDNJPANCSCIDMTWAILINIAMIKYWIOHMNSDVAWVMENHVTNDcontainerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json index aec76c448..35b0e5dd0 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/board.exp.json +++ b/e2etests/testdata/todo/container_child_edge/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg index e2c86e47a..df3ac9c7a 100644 --- a/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/container_child_edge/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="536" height="663" viewBox="-88 -88 536 663">containerfirstsecond 1->2c->2 +containerfirstsecond 1->2c->2 diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json index c36a465ab..f3951de5d 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#D2DBFD", + "fill": "#E3E9FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg index 5dda9ae06..bf4b4f2b7 100644 --- a/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_containers_large/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="664" height="716" viewBox="-100 -100 664 716">ninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneightninety ninesixty fourthirty twosixteeneighteightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json index dae1aff5b..d012e76be 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json +++ b/e2etests/testdata/todo/font_sizes_large/elk/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -134,7 +134,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -174,7 +174,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#F4F6FD", + "fill": "#F7F8FE", "stroke": "#0D32B2", "shadow": false, "3d": false, diff --git a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg index f42b3ddce..c417a43f7 100644 --- a/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg +++ b/e2etests/testdata/todo/font_sizes_large/elk/sketch.exp.svg @@ -18,7 +18,7 @@ width="789" height="2014" viewBox="-39 -88 789 2014">eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one +eightsixteenthirty twosixty fourninety nine twelvetwenty fourforty eighteighty one diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json index 8e5611289..bf9dc2e70 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/board.exp.json @@ -14,7 +14,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -54,7 +54,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -94,7 +94,7 @@ "strokeDash": 0, "strokeWidth": 2, "borderRadius": 0, - "fill": "#E7EAFF", + "fill": "#EDF0FD", "stroke": "#0D32B2", "shadow": false, "3d": false, @@ -563,7 +563,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -602,7 +602,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", @@ -641,7 +641,7 @@ "opacity": 1, "strokeDash": 6, "strokeWidth": 2, - "stroke": "#2952E4", + "stroke": "#0D32B2", "label": "", "fontSize": 16, "fontFamily": "DEFAULT", diff --git a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg index e9cb1975f..45f3f9430 100644 --- a/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg +++ b/e2etests/testdata/todo/sequence_diagram_actor_padding_nested_groups/dagre/sketch.exp.svg @@ -18,7 +18,7 @@ width="921" height="1242" viewBox="-147 -26 921 1242">bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo bacthis is a message groupand this is a nested message groupwhat about more nestingyoyo ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel ab Thereoncewasaverytalledgelabel +ab Thereoncewasaverytalledgelabel ninetynineeighty eightseventy sevenninetynineeighty eightseventy sevenhellogoodbye \ No newline at end of file diff --git a/e2etests/testdata/regression/empty_sequence/elk/board.exp.json b/e2etests/testdata/regression/empty_sequence/elk/board.exp.json new file mode 100644 index 000000000..e5224a34d --- /dev/null +++ b/e2etests/testdata/regression/empty_sequence/elk/board.exp.json @@ -0,0 +1,126 @@ +{ + "name": "", + "shapes": [ + { + "id": "A", + "type": "sequence_diagram", + "pos": { + "x": 25, + "y": 12 + }, + "width": 140, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#FFFFFF", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "hello", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": true, + "underline": false, + "labelWidth": 40, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + }, + { + "id": "B", + "type": "sequence_diagram", + "pos": { + "x": 12, + "y": 238 + }, + "width": 166, + "height": 126, + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 0, + "borderRadius": 0, + "fill": "#FFFFFF", + "stroke": "#0D32B2", + "shadow": false, + "3d": false, + "multiple": false, + "tooltip": "", + "link": "", + "icon": null, + "iconPosition": "", + "blend": false, + "fields": null, + "methods": null, + "columns": null, + "label": "goodbye", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#0A0F25", + "italic": false, + "bold": true, + "underline": false, + "labelWidth": 66, + "labelHeight": 26, + "labelPosition": "INSIDE_MIDDLE_CENTER", + "zIndex": 0, + "level": 1 + } + ], + "connections": [ + { + "id": "(A -> B)[0]", + "src": "A", + "srcArrow": "none", + "srcLabel": "", + "dst": "B", + "dstArrow": "triangle", + "dstLabel": "", + "opacity": 1, + "strokeDash": 0, + "strokeWidth": 2, + "stroke": "#0D32B2", + "label": "", + "fontSize": 16, + "fontFamily": "DEFAULT", + "language": "", + "color": "#676C7E", + "italic": true, + "bold": false, + "underline": false, + "labelWidth": 0, + "labelHeight": 0, + "labelPosition": "", + "labelPercentage": 0, + "route": [ + { + "x": 95, + "y": 138 + }, + { + "x": 95, + "y": 238 + } + ], + "animated": false, + "tooltip": "", + "icon": null, + "zIndex": 0 + } + ] +} diff --git a/e2etests/testdata/regression/empty_sequence/elk/sketch.exp.svg b/e2etests/testdata/regression/empty_sequence/elk/sketch.exp.svg new file mode 100644 index 000000000..34c98543a --- /dev/null +++ b/e2etests/testdata/regression/empty_sequence/elk/sketch.exp.svg @@ -0,0 +1,28 @@ + +hellogoodbye \ No newline at end of file From 121d75c8df2ec43b2ee142d559f23bd604d6c6af Mon Sep 17 00:00:00 2001 From: Alexander Wang Date: Mon, 5 Dec 2022 17:26:45 -0800 Subject: [PATCH 29/29] changelog massaging --- ci/release/changelogs/next.md | 80 +++++++++++++++++++++-------------- 1 file changed, 48 insertions(+), 32 deletions(-) diff --git a/ci/release/changelogs/next.md b/ci/release/changelogs/next.md index e76476e8c..8de782117 100644 --- a/ci/release/changelogs/next.md +++ b/ci/release/changelogs/next.md @@ -1,62 +1,78 @@ +When we launched D2 to open-source 2 weeks ago, we left the sprint after it a completely +blank slate. Because, while we do have long-term goals, we wanted to make the first +post-launch update focused 100% on addressing the biggest pain points that came up. Thank +you so much to everyone who asked for or complained about something. Every item in this +release was something that was posted on the D2 Discord, a GitHub issue/discussion, a +comment on social media, or an email. + +On top of the listed changes to core D2, we have been building out integrations, starting +with [Obsidian](https://github.com/terrastruct/d2-obsidian). Work has also begun on the +API and Playground. + +If you want a fast way to check out what a change looks like, we put screenshots in the +PRs when it's a visual change. + #### Features ๐Ÿš€ -- Sequence diagrams are now supported. See [docs](https://d2lang.com/tour/sequence-diagrams) for more. +- Sequence diagrams are now supported, experimentally. See + [docs](https://d2lang.com/tour/sequence-diagrams). [#99](https://github.com/terrastruct/d2/issues/99) -- Formatting of d2 scripts is supported on the CLI with the `fmt` subcommand. - [#292](https://github.com/terrastruct/d2/pull/292) -- Latex is now supported. See [docs](https://d2lang.com/tour/text) for more. +- Formatting of d2 scripts is supported on the CLI with the `fmt` subcommand. See `man d2` + or `d2 --help`. [#292](https://github.com/terrastruct/d2/pull/292) +- Latex is now supported. See [docs](https://d2lang.com/tour/text) for how to use. [#229](https://github.com/terrastruct/d2/pull/229) -- `direction` keyword is now supported to specify `up`, `down`, `right`, `left` layouts. See - [docs](https://d2lang.com/tour/layouts) for more. +- `direction` keyword is now supported to specify `up`, `down`, `right`, `left` layouts. + See [docs](https://d2lang.com/tour/layouts) for more. [#251](https://github.com/terrastruct/d2/pull/251) -- Self-referencing connections are now valid. E.g. `x -> x`. - [#273](https://github.com/terrastruct/d2/pull/273) +- Self-referencing connections are now valid. E.g. `x -> x`. Render will vary based on + layout engine. [#273](https://github.com/terrastruct/d2/pull/273) - Arrowhead labels are now supported. [#182](https://github.com/terrastruct/d2/pull/182) -- `stroke-dash` on shapes is now supported. [#188](https://github.com/terrastruct/d2/issues/188) -- `font-color` is now supported on shapes and connections. [#215](https://github.com/terrastruct/d2/pull/215) -- `font-size` is now supported on shapes and connections. [#250](https://github.com/terrastruct/d2/pull/250) -- Querying shapes and connections by ID is now supported in renders. [#218](https://github.com/terrastruct/d2/pull/218) +- Support for `stroke-dash` on shapes. + [#188](https://github.com/terrastruct/d2/issues/188) +- Support for `font-color` on shapes and connections. + [#215](https://github.com/terrastruct/d2/pull/215) +- Support for `font-size` on shapes and connections. + [#250](https://github.com/terrastruct/d2/pull/250) +- HTML IDs are now added in the SVG output. You can use this to query shapes and + connections by ID post-render. [#218](https://github.com/terrastruct/d2/pull/218) +- `-b/--bundle` flag to `d2` bundles all image assets directly as base64 data urls. + [#278](https://github.com/terrastruct/d2/pull/278) - [install.sh](./install.sh) now accepts `-d` as an alias for `--dry-run`. [#266](https://github.com/terrastruct/d2/pull/266) -- `-b/--bundle` flag to `d2` now works and bundles all image assets directly as base64 - data urls. [#278](https://github.com/terrastruct/d2/pull/278) #### Improvements ๐Ÿงน -- Local images can now be included, e.g. `icon: ./my_img.png`. - [#146](https://github.com/terrastruct/d2/issues/146) +- Local images can now be used for values to the `icon` keyword, e.g. `icon: + ./my_img.png`. [#146](https://github.com/terrastruct/d2/issues/146) - Connection labels no longer overlap other connections. [#332](https://github.com/terrastruct/d2/pull/332) - ELK layout engine now defaults to top-down to be consistent with dagre. [#251](https://github.com/terrastruct/d2/pull/251) -- [install.sh](./install.sh) prints the dry run message more visibly. - [#266](https://github.com/terrastruct/d2/pull/266) -- `d2` now lives in the root folder of the repository instead of as a subcommand. - So you can run `go install oss.terrastruct.com/d2@latest` to install from source - now. - [#290](https://github.com/terrastruct/d2/pull/290) - Container default font styling is no longer bold. Everything used to look too bold. [#358](https://github.com/terrastruct/d2/pull/358) -- `BROWSER=0` now works to disable opening a browser on `--watch`. +- `BROWSER=0` will disable opening a browser on `--watch`. [#311](https://github.com/terrastruct/d2/pull/311) +- [install.sh](./install.sh) prints the dry run message more visibly. + [#266](https://github.com/terrastruct/d2/pull/266) +- `d2` now lives in the root folder of the repository instead of as a subcommand. So you + can now run `go install oss.terrastruct.com/d2@latest` to install from source. + [#290](https://github.com/terrastruct/d2/pull/290) #### Bugfixes โ›‘๏ธ - 3D style was missing border and other styles for its top and right faces. [#187](https://github.com/terrastruct/d2/pull/187) -- System dark mode was incorrectly applying to markdown in renders. +- System dark mode was incorrectly applying to Markdown in renders. [#159](https://github.com/terrastruct/d2/issues/159) -- Fixes markdown newlines created with a trailing double space or backslash. +- Fixes Markdown newlines created with a trailing double space or backslash. [#214](https://github.com/terrastruct/d2/pull/214) - Fixes images not loading in PNG exports. [#224](https://github.com/terrastruct/d2/pull/224) -- Fixes label and icon overlapping each other in dagre and elk layouts. +- Fixes label and icon overlapping each other in dagre and ELK layouts. [#343](https://github.com/terrastruct/d2/pull/343) -- Avoid logging benign file watching errors. +- No longer log benign file-watching errors. [#293](https://github.com/terrastruct/d2/pull/293) -- `$BROWSER` now works to open a custom browser correctly. - For example, to open Firefox on macOS: `BROWSER='open -aFirefox'` - [#311](https://github.com/terrastruct/d2/pull/311) +- `$BROWSER` now works to open a custom browser correctly. For example, to open Firefox on + macOS: `BROWSER='open -a Firefox'` [#311](https://github.com/terrastruct/d2/pull/311) - Fixes numbered IDs being wrongly positioned in `dagre` - [#321](https://github.com/terrastruct/d2/issues/321). Thank you @pleshevskiy for the - report. + [#321](https://github.com/terrastruct/d2/issues/321).